KRIT1 Antibody

Contact us
Catalog number: R32542
Price: 573 €
Supplier: genways
Product name: KRIT1 Antibody
Quantity: 1 vial
Other quantities: 0.1ml 263€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: KRIT1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This KRIT1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O00522
Purity: Antigen affinity
Description: It associates with junction proteins and RAS-related protein 1A (Rap1A), It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), It is also a microtubule-associated protein and may play a role in microtubule targeting, Multiple alternatively spliced transcript variants have been found for this gene, Mutations in this gene result in cerebral cavernous malformations, The encoded protein is localized in the nucleus and cytoplasm, This gene encodes a protein containing four ankyrin repeats, a band 4, and multiple NPXY sequences, and plays a critical role in beta1-integrin-mediated cell proliferation, which requires the encoded protein for maintaining the integrity of endothelial junctions, 1/ezrin/radixin/moesin (FERM) domain, Krev interaction trapped protein 1 is a protein that in humans is encoded by the CCM1 gene
Immunogen: Amino acids 703-736 (ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS) from the human protein were used as the immunogen for the KRIT1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the KRIT1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: KRIT1
Short name: KRIT1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: KRIT1 (Antibody to)
Alternative technique: antibodies
Identity: 1573
Gene: KRIT1 | More about : KRIT1
Long gene name: KRIT1, ankyrin repeat containing
Synonyms gene: CCM1
Synonyms gene name: cerebral cavernous malformations 1
Synonyms: CAM
Locus: 7q21, 2
Discovery year: 1995-06-02
GenBank acession: AJ294850
Entrez gene record: 889
Pubmed identfication: 7604043 11342228
Classification: Ankyrin repeat domain containing FERM domain containing
Havana BLAST/BLAT: OTTHUMG00000131187
Locus Specific Databases: LRG_650

Related Products :

GENTAUR-58be5035240de Anti- KRIT1 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be50359ee9f Anti- KRIT1 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be50360e5a3 Anti- KRIT1 Antibody 100ug 387 € MBS Polyclonals human
AP26021PU-L anti-KRIT1 / CCM1 Antibody 0,2 mg 587 € acr human
AP26021PU-N anti-KRIT1 / CCM1 Antibody 0,1 mg 442 € acr human
AR26002PU-N anti-KRIT1 / CCM1 (His-tag) Antibody 20 Вµg 340 € acr human
R32542 KRIT1 Antibody 0.1mg 406 € NJS poly human
bs-8546R-A350 KRIT1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8546R-A488 KRIT1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8546R-A555 KRIT1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8546R-A594 KRIT1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8546R-A647 KRIT1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8546R-Biotin KRIT1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-8546R KRIT1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-8546R-Cy3 KRIT1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8546R-Cy5 KRIT1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8546R-Cy5.5 KRIT1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8546R-Cy7 KRIT1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8546R-FITC KRIT1 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-8546R-HRP KRIT1 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8546R-PE KRIT1 Antibody, PE Conjugated 0.1ml 368 € Bioss Primary Conjugated Antibodies human
YSRTMCA3995Z KRIT1, Mouse Monoclonal antibody-; Clone: 2C7 0.1 mg Ask price € accurate-monoclonals mouse
GENTAUR-58be668e13f32 Anti-KRIT1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx921939 Anti-KRIT1 siRNA inquire 50 € abbex human
abx921940 Anti-KRIT1 siRNA inquire 50 € abbex human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human
GWB-B43069 antibody to or anti-Apaf1 (Mouse) Monoclonal antibody , antibody 1 vial 573 € genways mouse