| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
KRIT1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This KRIT1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O00522 |
| Purity: |
Antigen affinity |
| Description: |
It associates with junction proteins and RAS-related protein 1A (Rap1A), It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), It is also a microtubule-associated protein and may play a role in microtubule targeting, Multiple alternatively spliced transcript variants have been found for this gene, Mutations in this gene result in cerebral cavernous malformations, The encoded protein is localized in the nucleus and cytoplasm, This gene encodes a protein containing four ankyrin repeats, a band 4, and multiple NPXY sequences, and plays a critical role in beta1-integrin-mediated cell proliferation, which requires the encoded protein for maintaining the integrity of endothelial junctions, 1/ezrin/radixin/moesin (FERM) domain, Krev interaction trapped protein 1 is a protein that in humans is encoded by the CCM1 gene |
| Immunogen: |
Amino acids 703-736 (ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS) from the human protein were used as the immunogen for the KRIT1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the KRIT1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
KRIT1 |
| Short name: |
KRIT1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
KRIT1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
1573 |
| Gene: |
KRIT1 |
More about : KRIT1 |
| Long gene name: |
KRIT1, ankyrin repeat containing |
| Synonyms gene: |
CCM1 |
| Synonyms gene name: |
cerebral cavernous malformations 1 |
| Synonyms: |
CAM |
| Locus: |
7q21, 2 |
| Discovery year: |
1995-06-02 |
| GenBank acession: |
AJ294850 |
| Entrez gene record: |
889 |
| Pubmed identfication: |
7604043 11342228 |
| Classification: |
Ankyrin repeat domain containing FERM domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000131187 |
| Locus Specific Databases: |
LRG_650 |