GPI Antibody / Glucose-6-phosphate isomerase

Contact us
Catalog number: R32537
Price: 869 €
Supplier: DL elisas
Product name: GPI Antibody / Glucose-6-phosphate isomerase
Quantity: 96T
Other quantities: 0.1mg 406€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: GPI / Glucose-6-phosphate isomerase
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This Glucose-6-phosphate isomerase antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P06745
Purity: Antigen affinity
Description: Alternative splicing results in multiple transcript variants, Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, Extracellularly, In the cytoplasm, The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions, The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor, This gene encodes a member of the glucose phosphate isomerase protein family, alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase (PHI), and as a lymphokine that induces immunoglobulin secretion, immediate neonatal death and neurological impairment, is an enzyme that in humans is encoded by the GPI gene on chromosome 19, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate, Glucose-6-phosphate isomerase (GPI)
Immunogen: Amino acids 2-39 (AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN) from the mouse protein were used as the immunogen for the Glucose-6-phosphate isomerase antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Glucose-6-phosphate isomerase antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: GPI / Glucose-6-phosphate isomerase
Short name: GPI Antibody / Glucose-6-phosphate isomerase
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: glucose-6-phosphate isomerase (Antibody to) / Glucose-6-phosphate isomerase
Alternative technique: antibodies
Alternative to gene target: AMF and GNPI and NLK and PGI and PHI and SA-36 and SA36, GPI and IDBG-42902 and ENSG00000105220 and 2821, GPI and IDBG-635386 and ENSBTAG00000006396 and 280808, monosaccharide binding, nuclei, this GO :0001525 and angiogenesis and biological process this GO :0004347 and glucose-6-phosphate isomerase activity and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005975 and carbohydrate metabolic process and biological process this GO :0006006 and glucose metabolic process and biological process this GO :0006094 and gluconeogenesis and biological process this GO :0006096 and glycolytic process and biological process this GO :0006959 and humoral immune response and biological process this GO :0007599 and hemostasis and biological process this GO :0007611 and learning or memory and biological process this GO :0008083 and growth factor activity and molecular function this GO :0016020 and membrane and cellular component this GO :0016866 and intramolecular transferase activity and molecular function this GO :0019242 and methylglyoxal biosynthetic process and biological process this GO :0043005 and neuron projection and cellular component this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0046185 and aldehyde catabolic process and biological process this GO :0048029 and monosaccharide binding and molecular function this GO :0051156 and glucose 6-phosphate metabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004347 : glucose-6-phosphate isomerase activity, this GO :0004347 : glucose-6-phosphate isomerase activity and also this GO :0005125 : cytokine activity and also this GO :0008083 : growth factor activity and also this GO :0016866 : intramolecular transferase activity and also this GO :0048029 : monosaccharide binding, this GO :0005125 : cytokine activity, this GO :0008083 : growth factor activity, this GO :0016866 : intramolecular transferase activity, this GO :0048029 : monosaccharide binding, glucose-6-phosphate isomerase
Identity: 4458
Gene: GPI | More about : GPI
Long gene name: glucose-6-phosphate isomerase
Synonyms gene name: glucose phosphate isomerase
Synonyms: AMF NLK
Locus: 19q13, 11
Discovery year: 2001-06-22
GenBank acession: M61214
Entrez gene record: 2821
Pubmed identfication: 2387591 8575767
Havana BLAST/BLAT: OTTHUMG00000182087

Related Products :

MBS623435 GPI8, NT (GPI-anchor Transamidase, GPI Transamidase, Phosphatidylinositol-glycan Biosynthesis, Class K Protein, PIG-K, hGPI8, GPI8 Homolog, PIGK) Antibody 200ul 603 € MBS Polyclonals_1 human
AR09229PU-L anti-Glucose-6-phosphate isomerase (GPI) (1-558, His-tag) Antibody 0,5 mg 1138 € acr human
AR09229PU-N anti-Glucose-6-phosphate isomerase (GPI) (1-558, His-tag) Antibody 0,1 mg 485 € acr human
AR51987PU-N anti-Glucose-6-phosphate isomerase (GPI) (1-558, His-tag) Antibody 0,1 mg 587 € acr human
AR51987PU-S anti-Glucose-6-phosphate isomerase (GPI) (1-558, His-tag) Antibody 20 Вµg 311 € acr human
AP10042PU-N anti-Glucose-6-phosphate isomerase (GPI) (81-93) Antibody 0,1 mg 558 € acr human
AM06224SU-N anti-Glucose-6-phosphate isomerase (GPI) Antibody 0,1 ml 688 € acr human
AP10043PU-N anti-Glucose-6-phosphate isomerase (GPI) Antibody 0,1 mg 558 € acr human
AP54973SU-N anti-Glucose-6-phosphate isomerase (GPI) Antibody 0,2 ml 630 € acr human
GENTAUR-58bdc272618e4 Anti- Glucose 6 Phosphate Isomerase (GPI) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc272b6db7 Anti- Glucose 6 Phosphate Isomerase (GPI) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdcf8e64958 Anti- Glucose 6 Phosphate Isomerase (GPI) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdcf8ed423f Anti- Glucose 6 Phosphate Isomerase (GPI) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdd1709e7e4 Anti- Glucose 6 Phosphate Isomerase (GPI) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd1b688d90 Anti- Glucose 6 Phosphate Isomerase (GPI) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd50a59cef Anti- Glucose 6 Phosphate Isomerase (GPI) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd6bc179e0 Anti- Glucose 6 Phosphate Isomerase (GPI) Antibody 100ug 531 € MBS Polyclonals human
AP51910PU-N anti-Glucose-6-phosphate isomerase (GPI) (C-term) Antibody 0,4 ml 587 € acr human
AP54972SU-N anti-Glucose-6-phosphate isomerase (GPI) pSer185 Antibody 0,2 ml 630 € acr human
R32536 GPI Antibody / Glucose-6-phosphate isomerase 0.1mg 406 € NJS poly human
R32537 GPI Antibody / Glucose-6-phosphate isomerase 0.1mg 406 € NJS poly human
MBS612810 Gpihbp1 (GPI-anchored HDL-binding protein 1, GPI-anchored High-Density Lipid-binding protein 1, GlycosylPhosphatidylInositol-anchored high-density lipoprotein-binding protein 1) Antibody 100ul 608 € MBS Polyclonals_1 human
abx574994 Anti-Rat Glucose 6 Phosphate Isomerase (GPI) ELISA Kit inquire 50 € abbex rat
AE41466PI-48 ELISA test for Pig Glucose-6-phosphate isomerase (GPI) 1x plate of 48 wells 402 € abebio pig
AE41465RB-48 ELISA test for Rabbit Glucose-6-phosphate isomerase (GPI) 1x plate of 48 wells 402 € abebio human
EKU04409 Glucose 6 Phosphate Isomerase (GPI) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU04410 Glucose 6 Phosphate Isomerase (GPI) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
EKU04411 Glucose 6 Phosphate Isomerase (GPI) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
DL-AMF-Hu Human Glucose 6 Phosphate Isomerase GPI ELISA Kit 96T 846 € DL elisas human
DL-AMF-Mu Mouse Glucose 6 Phosphate Isomerase GPI ELISA Kit 96T 869 € DL elisas mouse