| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
GPI / Glucose-6-phosphate isomerase |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This GPI antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P06744 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in multiple transcript variants, Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, Extracellularly, In the cytoplasm, The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions, The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor, This gene encodes a member of the glucose phosphate isomerase protein family, alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), and as a lymphokine that induces immunoglobulin secretion, immediate neonatal death and neurological impairment, is an enzyme that in humans is encoded by the GPI gene on chromosome 19, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate, Glucose-6-phosphate isomerase (GPI) |
| Immunogen: |
Amino acids 5-39 (TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH) from the human protein were used as the immunogen for the GPI antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the GPI antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
GPI / Glucose-6-phosphate isomerase |
| Short name: |
GPI Antibody / Glucose-6-phosphate isomerase |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
glucose-6-phosphate isomerase (Antibody to) / Glucose-6-phosphate isomerase |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
AMF and GNPI and NLK and PGI and PHI and SA-36 and SA36, GPI and IDBG-42902 and ENSG00000105220 and 2821, GPI and IDBG-635386 and ENSBTAG00000006396 and 280808, monosaccharide binding, nuclei, this GO :0001525 and angiogenesis and biological process this GO :0004347 and glucose-6-phosphate isomerase activity and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005975 and carbohydrate metabolic process and biological process this GO :0006006 and glucose metabolic process and biological process this GO :0006094 and gluconeogenesis and biological process this GO :0006096 and glycolytic process and biological process this GO :0006959 and humoral immune response and biological process this GO :0007599 and hemostasis and biological process this GO :0007611 and learning or memory and biological process this GO :0008083 and growth factor activity and molecular function this GO :0016020 and membrane and cellular component this GO :0016866 and intramolecular transferase activity and molecular function this GO :0019242 and methylglyoxal biosynthetic process and biological process this GO :0043005 and neuron projection and cellular component this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0046185 and aldehyde catabolic process and biological process this GO :0048029 and monosaccharide binding and molecular function this GO :0051156 and glucose 6-phosphate metabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004347 : glucose-6-phosphate isomerase activity, this GO :0004347 : glucose-6-phosphate isomerase activity and also this GO :0005125 : cytokine activity and also this GO :0008083 : growth factor activity and also this GO :0016866 : intramolecular transferase activity and also this GO :0048029 : monosaccharide binding, this GO :0005125 : cytokine activity, this GO :0008083 : growth factor activity, this GO :0016866 : intramolecular transferase activity, this GO :0048029 : monosaccharide binding, glucose-6-phosphate isomerase |
| Identity: |
4458 |
| Gene: |
GPI |
More about : GPI |
| Long gene name: |
glucose-6-phosphate isomerase |
| Synonyms gene name: |
glucose phosphate isomerase |
| Synonyms: |
AMF NLK |
| Locus: |
19q13, 11 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M61214 |
| Entrez gene record: |
2821 |
| Pubmed identfication: |
2387591 8575767 |
| Havana BLAST/BLAT: |
OTTHUMG00000182087 |