| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
E2F4 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This E2F4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q16254 |
| Purity: |
Antigen affinity |
| Description: |
The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses, This protein binds to all three of the tumor suppressor proteins pRB, but with higher affinity to the last two, p107 and p130, E2F4 is a member of the E2F family of transcription factors |
| Immunogen: |
Amino acids 106-144 (ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) from the human protein were used as the immunogen for the E2F4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the E2F4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
nuclear, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
E2F4 |
| Short name: |
E2F4 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
E2F4 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
3118 |
| Gene: |
E2F4 |
More about : E2F4 |
| Long gene name: |
E2F transcription factor 4 |
| Synonyms gene name: |
E2F transcription factor 4, p107/p130-binding |
| Synonyms: |
E2F-4 |
| Locus: |
16q22, 1 |
| Discovery year: |
1995-02-01 |
| GenBank acession: |
BC021050 |
| Entrez gene record: |
1874 |
| Pubmed identfication: |
7958924 7892279 |
| RefSeq identity: |
NM_001950 |
| Classification: |
E2F transcription factors |
| Havana BLAST/BLAT: |
OTTHUMG00000172975 |