E2F4 Antibody

Contact us
Catalog number: R32525
Price: 406 €
Supplier: NJS poly
Product name: E2F4 Antibody
Quantity: 0.1mg
Other quantities: 0.1mg 389€ 1 vial 486€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: E2F4
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This E2F4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q16254
Purity: Antigen affinity
Description: The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses, This protein binds to all three of the tumor suppressor proteins pRB, but with higher affinity to the last two, p107 and p130, E2F4 is a member of the E2F family of transcription factors
Immunogen: Amino acids 106-144 (ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) from the human protein were used as the immunogen for the E2F4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the E2F4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: nuclear, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: E2F4
Short name: E2F4 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: E2F4 (Antibody to)
Alternative technique: antibodies
Identity: 3118
Gene: E2F4 | More about : E2F4
Long gene name: E2F transcription factor 4
Synonyms gene name: E2F transcription factor 4, p107/p130-binding
Synonyms: E2F-4
Locus: 16q22, 1
Discovery year: 1995-02-01
GenBank acession: BC021050
Entrez gene record: 1874
Pubmed identfication: 7958924 7892279
RefSeq identity: NM_001950
Classification: E2F transcription factors
Havana BLAST/BLAT: OTTHUMG00000172975

Related Products :

GENTAUR-58bd607f4da2e Human Transcription factor E2F4 (E2F4) 100ug 2161 € MBS Recombinant Proteins human
GENTAUR-58bd607fac390 Human Transcription factor E2F4 (E2F4) 1000ug 2161 € MBS Recombinant Proteins human
GENTAUR-58bd607feaf0f Human Transcription factor E2F4 (E2F4) 100ug 2669 € MBS Recombinant Proteins human
GENTAUR-58bd6080438df Human Transcription factor E2F4 (E2F4) 1000ug 2669 € MBS Recombinant Proteins human
A03E0004 anti-E2F4 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AM20034AF-N anti-E2F4 Antibody 0,1 mg 558 € acr human
AP09986PU-N anti-E2F4 Antibody 0,1 mg 659 € acr human
C0178-1 anti-E2F4 Antibody 50 Вµg 347 € acr human
C0178-2 anti-E2F4 Antibody 0,1 mg 500 € acr human
CPA1360-100ul anti-E2F4 Antibody 0,1 ml 442 € acr human
CPA1360-200ul anti-E2F4 Antibody 0,2 ml 688 € acr human
CPA1360-30ul anti-E2F4 Antibody 30 Вµl 326 € acr human
DM382 anti-E2F4 Antibody 1 ml 1138 € acr human
DM382-05 anti-E2F4 Antibody 0,5 ml 746 € acr human
E2F4-401AP anti-E2F4 Antibody 100 µg 357 € fabgen human
GENTAUR-58bdee3bef7cc Anti- E2F4 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdee3c5272e Anti- E2F4 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdefda22178 Anti- E2F4 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdefda7c081 Anti- E2F4 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be48aedf4c4 Anti- E2F4 Antibody 100ug 370 € MBS Polyclonals human
E2F4-BIOTIN anti-E2F4 Antibody BIOTIN 100 µg 456 € fabgen human
E2F4-FITC anti-E2F4 Antibody FITC 100 µg 456 € fabgen human
AP09986CP-N anti-E2F4 Control Peptide Antibody 0,25 mg 413 € acr human
AP06091PU-N anti-E2F4/E2F5 Antibody 0,1 mg 558 € acr human
GWB-93C198 E2F4 antibody 1 vial 486 € genways human
GWB-A313E3 E2F4 antibody 1 vial 532 € genways human
GWB-A31669 E2F4 antibody 1 vial 591 € genways human
R31276 E2F4 Antibody 0.1mg 389 € NJS poly human
R32525 E2F4 Antibody 0.1mg 406 € NJS poly human
R33585-100UG E2F4 Antibody 0.1mg 406 € NJS poly human