AGO4 Antibody / Argonaute 4

Catalog number:	R32464 Buy Now
Price:	263 €
Supplier:	Bioss Primary Unconjugated Antibodies
Product name:	AGO4 Antibody / Argonaute 4
Quantity:	0.1ml
Related search:	argonaute gene antibody antibodies synonyms deg alternative

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	AGO4 / Argonaute 4
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	WB
Recommended dilutions:	5-1ug/ml, Western blot: 0
Added buffer:	025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use:	This AGO4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	Q9HCK5
Purity:	Antigen affinity
Description:	1, The encoded protein is highly basic containing PAZ and PIWI domains, This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference, This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, and it may play a role in short-interfering-RNA-mediated gene silencing, AGO4 (Argonaute 4) is also known as EIF2C4
Immunogen:	Amino acids KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD from the human protein were used as the immunogen for the AGO4 antibody
Storage:	After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the AGO4 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	AGO4 / Argonaute 4
Short name:	AGO4 Antibody / Argonaute 4
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	AGO4 (Antibody to) / Argonaute 4
Alternative technique:	antibodies
Identity:	18424
Gene:	AGO4 | More about : AGO4
Long gene name:	RISC catalytic component , argonaute 4
Synonyms gene:	EIF2C4
Synonyms gene name:	4 argonaute RISC catalytic component 4 , eukaryotic translation initiation factor 2C
Synonyms:	hAGO4 KIAA1567 FLJ20033
Synonyms name:	argonaute 4
Locus:	1p34, 3
Discovery year:	2002-04-26
GenBank acession:	AB046787
Entrez gene record:	192670
Pubmed identfication:	12906857
RefSeq identity:	NM_017629
Classification:	Argonaute/PIWI family
Havana BLAST/BLAT:	OTTHUMG00000004243

• #argonaute
• #gene
• #antibody
• #antibodies
• #synonyms
• #deg
• #alternative