AGO2 Antibody / Argonaute 2

Catalog number:	R32463 Buy Now
Price:	332 €
Supplier:	Bioss Primary Conjugated Antibodies.
Product name:	AGO2 Antibody / Argonaute 2
Quantity:	100ul
Related search:	gene argonaute antibody antibodies synonyms deg risc

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	AGO2 / Argonaute 2
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	WB
Recommended dilutions:	5-1ug/ml, Western blot: 0
Added buffer:	025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use:	This AGO2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	Q9UKV8
Purity:	Antigen affinity
Description:	It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing, Multiple transcript variants encoding different isoforms have been found for this gene, The encoded protein is highly basic, This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference, also known as AGO2, and contains a PAZ domain and a PIWI domain, is a protein that in humans is encoded by the EIF2C2 gene, Protein argonaute-2
Immunogen:	Amino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody
Storage:	After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the AGO2 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	AGO2 / Argonaute 2
Short name:	AGO2 Antibody / Argonaute 2
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	AGO2 (Antibody to) / Argonaute 2
Alternative technique:	antibodies
Identity:	3263
Gene:	AGO2 | More about : AGO2
Long gene name:	RISC catalytic component , argonaute 2
Synonyms gene:	EIF2C2 CASC7
Synonyms gene name:	2 argonaute RISC catalytic component 2 cancer susceptibility candidate 7 (non-protein coding) , eukaryotic translation initiation factor 2C
Synonyms:	hAGO2 Q10 LINC00980
Synonyms name:	argonaute 2
Locus:	8q24, 3
Discovery year:	2000-01-14
GenBank acession:	AF121255
Entrez gene record:	27161
Pubmed identfication:	10534406 12906857
RefSeq identity:	NM_012154
Classification:	Argonaute/PIWI family
Havana BLAST/BLAT:	OTTHUMG00000164232

• #gene
• #argonaute
• #antibody
• #antibodies
• #synonyms
• #deg
• #risc