ACVR2B Antibody / ActRIIB

Contact us
Catalog number: R32460
Price: 406 €
Supplier: NJS poly
Product name: ACVR2B Antibody / ActRIIB
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ACVR2B / ActRIIB
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 5-1ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This ACVR2B antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q13705
Purity: Antigen affinity
Description: Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins, Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors, These receptors are all transmembrane proteins, This ACVR2B gene encodes activin A type IIB receptor, Type I and II receptors form a stable complex after ligand binding, Type I receptors are essential for signaling, Type II receptors are considered to be constitutively active kinases, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity, and type II receptors are required for binding ligands and for expression of type I receptors, composed of a ligand-binding extracellular domain with cysteine-rich region, resulting in phosphorylation of type I receptors by type II receptors, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor, Activin receptor type-2B is a protein that in humans is encoded by the ACVR2B gene
Immunogen: Amino acids VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE from the human protein were used as the immunogen for the ACVR2B antibody
Storage: After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the ACVR2B antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ACVR2B / ActRIIB
Short name: ACVR2B Antibody / ActRIIB
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: ACVR2B (Antibody to) / ActRIIB
Alternative technique: antibodies
Identity: 174
Gene: ACVR2B | More about : ACVR2B
Long gene name: activin A receptor type 2B
Synonyms gene name: activin A receptor, type IIB
Synonyms: ActR-IIB
Locus: 3p22, 2
Discovery year: 1997-03-19
GenBank acession: X77533
Entrez gene record: 93
Pubmed identfication: 8161782 9621519
RefSeq identity: NM_001106
Classification: Type 2 receptor serine/threonine kinases
Havana BLAST/BLAT: OTTHUMG00000131291

Related Products :