| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
HMGB2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0 |
| Added buffer: |
025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2 |
| Intented use: |
This HMGB2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P26583 |
| Purity: |
Antigen affinity |
| Description: |
In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles, The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells, These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility, This gene encodes a member of the non-histone chromosomal high mobility group protein family, This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene, High-mobility group protein B2 |
| Immunogen: |
Amino acids KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR were used as the immunogen for the HMGB2 antibody |
| Storage: |
After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the HMGB2 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution |
| Localization: |
Nuclear |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
HMGB2 |
| Short name: |
HMGB2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
high mobility family box 2 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
DNA binding, DNA ligation and biological process this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006325 and chromatin organization and biological process this GO :0006334 and nucleosome assembly and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006915 and apoptotic process and biological process this GO :0006921 and cellular component disassembly involved in execution phase of apoptosis and biological process this GO :0007283 and spermatogenesis and biological process this GO :0007289 and spermatid nucleus differentiation and biological process this GO :0008301 and DNA binding, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048545 and response to steroid hormone and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050918 and positive chemotaxis and biological process this GO :0051103 and DNA ligation involved in DNA repair and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :1902042 and negative regulation of extrinsic apoptotic signaling pathway via death domain receptors and biological process, HMG2, HMGB2 and IDBG-44657 and ENSG00000164104 and 3148, HMGB2 and IDBG-629304 and ENSBTAG00000015101 and 540444, Hmgb2 and IDBG-156235 and ENSMUSG00000054717 and 97165, bending, bending and also this GO :0019904 : protein domain specific binding and also this GO :0042056 : chemoattractant activity and also this GO :0044212 : transcription regulatory region DNA binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0050786 : RAGE receptor binding, bending and molecular function this GO :0008584 and male this GO nad development and biological process this GO :0019904 and protein domain specific binding and molecular function this GO :0032075 and positive regulation of nuclease activity and biological process this GO :0033151 and V(D)J recombination and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0043234 and protein complex and cellular component this GO :0043388 and positive regulation of DNA binding and biological process this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045648 and positive regulation of erythrocyte differentiation and biological process this GO :0045654 and positive regulation of megakaryocyte differentiation and biological process this GO :0045892 and negative regulation of transcription, nuclei, this GO :0000793 and condensed chromosome and cellular component this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003684 and damaged DNA binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003697 and single-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006265 and DNA topological change and biological process this GO :0006288 and base-excision repair, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003684 : damaged DNA binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003697 : single-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0008301 : DNA binding, this GO :0003684 : damaged DNA binding, this GO :0003690 : double-stranded DNA binding, this GO :0003697 : single-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0008301 : DNA binding, this GO :0019904 : protein domain specific binding, this GO :0042056 : chemoattractant activity, this GO :0044212 : transcription regulatory region DNA binding, this GO :0044822 : poly(A) RNA binding, this GO :0050786 : RAGE receptor binding, 618297, high mobility group box 2 |
| Identity: |
5000 |
| Gene: |
HMGB2 |
More about : HMGB2 |
| Long gene name: |
high mobility group box 2 |
| Synonyms gene: |
HMG2 |
| Synonyms gene name: |
high-mobility group (nonhistone chromosomal) protein 2 high-mobility group box 2 |
| Locus: |
4q34, 1 |
| Discovery year: |
1993-12-13 |
| Entrez gene record: |
3148 |
| Pubmed identfication: |
1754403 |
| RefSeq identity: |
NM_001130688 |
| Classification: |
Canonical high mobility group |
| Havana BLAST/BLAT: |
OTTHUMG00000160799 |