HMGB2 Antibody

Contact us
Catalog number: R32439
Price: 495 €
Supplier: Zyagen
Product name: HMGB2 Antibody
Quantity: 0.1mg
Other quantities: 0.08 ml 199€ 0.4 ml 406€ 1 vial 521€ 1 x 1 vial 486€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: HMGB2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 5-1ug/ml, IHC (FFPE): 1-2ug/ml, Western blot: 0
Added buffer: 025% sodium azide, 5% BSA and 0, Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2
Intented use: This HMGB2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P26583
Purity: Antigen affinity
Description: In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles, The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells, These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility, This gene encodes a member of the non-histone chromosomal high mobility group protein family, This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene, High-mobility group protein B2
Immunogen: Amino acids KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR were used as the immunogen for the HMGB2 antibody
Storage: After reconstitution, Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, store at 4oC, the HMGB2 antibody may be kept for up to one month refrigerated at +4 degrees C, For long-term, Prior to reconstitution
Localization: Nuclear
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: HMGB2
Short name: HMGB2 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: high mobility family box 2 (Antibody to)
Alternative technique: antibodies
Alternative to gene target: DNA binding, DNA ligation and biological process this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006325 and chromatin organization and biological process this GO :0006334 and nucleosome assembly and biological process this GO :0006357 and regulation of transcription from RNA polymerase II promoter and biological process this GO :0006915 and apoptotic process and biological process this GO :0006921 and cellular component disassembly involved in execution phase of apoptosis and biological process this GO :0007283 and spermatogenesis and biological process this GO :0007289 and spermatid nucleus differentiation and biological process this GO :0008301 and DNA binding, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048545 and response to steroid hormone and biological process this GO :0050786 and RAGE receptor binding and molecular function this GO :0050918 and positive chemotaxis and biological process this GO :0051103 and DNA ligation involved in DNA repair and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :1902042 and negative regulation of extrinsic apoptotic signaling pathway via death domain receptors and biological process, HMG2, HMGB2 and IDBG-44657 and ENSG00000164104 and 3148, HMGB2 and IDBG-629304 and ENSBTAG00000015101 and 540444, Hmgb2 and IDBG-156235 and ENSMUSG00000054717 and 97165, bending, bending and also this GO :0019904 : protein domain specific binding and also this GO :0042056 : chemoattractant activity and also this GO :0044212 : transcription regulatory region DNA binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0050786 : RAGE receptor binding, bending and molecular function this GO :0008584 and male this GO nad development and biological process this GO :0019904 and protein domain specific binding and molecular function this GO :0032075 and positive regulation of nuclease activity and biological process this GO :0033151 and V(D)J recombination and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0043234 and protein complex and cellular component this GO :0043388 and positive regulation of DNA binding and biological process this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0045648 and positive regulation of erythrocyte differentiation and biological process this GO :0045654 and positive regulation of megakaryocyte differentiation and biological process this GO :0045892 and negative regulation of transcription, nuclei, this GO :0000793 and condensed chromosome and cellular component this GO :0001938 and positive regulation of endothelial cell proliferation and biological process this GO :0003677 and DNA binding and molecular function this GO :0003684 and damaged DNA binding and molecular function this GO :0003690 and double-stranded DNA binding and molecular function this GO :0003697 and single-stranded DNA binding and molecular function this GO :0003700 and sequence-specific DNA binding transcription factor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005654 and nucleoplasm and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006265 and DNA topological change and biological process this GO :0006288 and base-excision repair, this GO :0003677 : DNA binding, this GO :0003677 : DNA binding and also this GO :0003684 : damaged DNA binding and also this GO :0003690 : double-stranded DNA binding and also this GO :0003697 : single-stranded DNA binding and also this GO :0003700 : sequence-specific DNA binding transcription factor activity and also this GO :0005515 : protein binding and also this GO :0008301 : DNA binding, this GO :0003684 : damaged DNA binding, this GO :0003690 : double-stranded DNA binding, this GO :0003697 : single-stranded DNA binding, this GO :0003700 : sequence-specific DNA binding transcription factor activity, this GO :0005515 : protein binding, this GO :0008301 : DNA binding, this GO :0019904 : protein domain specific binding, this GO :0042056 : chemoattractant activity, this GO :0044212 : transcription regulatory region DNA binding, this GO :0044822 : poly(A) RNA binding, this GO :0050786 : RAGE receptor binding, 618297, high mobility group box 2
Identity: 5000
Gene: HMGB2 | More about : HMGB2
Long gene name: high mobility group box 2
Synonyms gene: HMG2
Synonyms gene name: high-mobility group (nonhistone chromosomal) protein 2 high-mobility group box 2
Locus: 4q34, 1
Discovery year: 1993-12-13
Entrez gene record: 3148
Pubmed identfication: 1754403
RefSeq identity: NM_001130688
Classification: Canonical high mobility group
Havana BLAST/BLAT: OTTHUMG00000160799

Related Products :

AM26689AF-N anti-HMGB1 / HMGB2 Antibody 0,1 mg 601 € acr human
A03H0069 anti-HMGB2 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdeaed81ff4 Anti- HMGB2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdeaeddc9bc Anti- HMGB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bded4017605 Anti- HMGB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bded4070c21 Anti- HMGB2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf606c47c9 Anti- HMGB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf6072b847 Anti- HMGB2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfcbb118b7 Anti- HMGB2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfcbb6b208 Anti- HMGB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0d2299c4d Anti- HMGB2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0d230fec7 Anti- HMGB2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3de75a32b Anti- HMGB2 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be3e5fb6abb Anti- HMGB2 Antibody 100ug 393 € MBS Polyclonals human
abx133474 Anti-HMGB2 Antibody 30 ul 267 € abbex human
abx146983 Anti-HMGB2 Antibody inquire 50 € abbex human
abx146984 Anti-HMGB2 Antibody inquire 50 € abbex human
AR39081PU-L anti-HMGB2 / HMG2 (1-209, His-tag) Antibody 0,5 mg 1500 € acr human
AR39081PU-N anti-HMGB2 / HMG2 (1-209, His-tag) Antibody 0,1 mg 587 € acr human
AM20898PU-N anti-HMGB2 / HMG2 Antibody 50 Вµg 819 € acr human
AM20899PU-N anti-HMGB2 / HMG2 Antibody 50 Вµg 819 € acr human
C10487-1 anti-HMGB2 / HMG2 Antibody 50 Вµg 347 € acr human
C10487-2 anti-HMGB2 / HMG2 Antibody 0,1 mg 500 € acr human
F50180-0.08ML HMGB2 Antibody 0.08 ml 199 € NJS poly human
F50180-0.4ML HMGB2 Antibody 0.4 ml 406 € NJS poly human
GWB-294E00 HMGB2 antibody 1 x 1 vial 486 € genways human
GWB-MV146B HMGB2 antibody 1 vial 521 € genways human
GWB-MV147C HMGB2 antibody 1 vial 521 € genways human
R32439 HMGB2 Antibody 0.1mg 406 € NJS poly human
BIN-003148-M03 HMGB2 Antibody (M03), clone 3C7 0.1mg 495 € Zyagen human