| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PTPN22 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the PTPN22 antibody should be determined by the researcher |
| Intented use: |
This PTPN22 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9Y2R2 |
| Purity: |
Antigen affinity |
| Description: |
Alternatively spliced transcript variants encoding distinct isoforms have been described, Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway, This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family, also known as PTPN22, is a protein that in humans is encoded by the PTPN22 gene, non-receptor type 22 (lymphoid), rheumatoid arthritis, systemic lupus erythematosus and Graves' disease, Protein tyrosine phosphatase |
| Immunogen: |
Amino acids MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK of human PTPN22 were used as the immunogen for the PTPN22 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PTPN22 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PTPN22 |
| Short name: |
PTPN22 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
non-receptor classification 22 (lymphoid) (Antibody to), protein tyrosine phosphatase |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
PTPN22 and IDBG-101222 and ENSG00000134242 and 26191, PTPN22 and IDBG-634891 and ENSBTAG00000019617 and, Ptpn22 and IDBG-181952 and ENSMUSG00000027843 and 19260, kinase binding, non-receptor type 22 (lymphoid), nuclei, this GO :0004725 and protein tyrosine phosphatase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006470 and protein dephosphorylation and biological process this GO :0009898 and cytoplasmic side of plasma membrane and cellular component this GO :0016311 and dephosphorylation and biological process this GO :0016791 and phosphatase activity and molecular function this GO :0017124 and SH3 domain binding and molecular function this GO :0019900 and kinase binding and molecular function this GO :0030217 and T cell differentiation and biological process this GO :0032817 and regulation of natural killer cell proliferation and biological process this GO :0035335 and peptidyl-tyrosine dephosphorylation and biological process this GO :0035644 and phosphoanandamide dephosphorylation and biological process this GO :0045088 and regulation of innate immune response and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0050855 and regulation of B cell receptor signaling pathway and biological process this GO :0050856 and regulation of T cell receptor signaling pathway and biological process this GO :0050860 and negative regulation of T cell receptor signaling pathway and biological process this GO :0050868 and negative regulation of T cell activation and biological process, this GO :0004725 : protein tyrosine phosphatase activity, this GO :0004725 : protein tyrosine phosphatase activity and also this GO :0005515 : protein binding and also this GO :0016791 : phosphatase activity and also this GO :0017124 : SH3 domain binding and also this GO :0019900 : kinase binding, this GO :0005515 : protein binding, this GO :0016791 : phosphatase activity, this GO :0017124 : SH3 domain binding, this GO :0019900 : kinase binding, protein tyrosine phosphatase |
| Identity: |
9652 |
| Gene: |
PTPN22 |
More about : PTPN22 |
| Long gene name: |
non-receptor type 22 , protein tyrosine phosphatase |
| Synonyms gene: |
PTPN8 |
| Synonyms gene name: |
non-receptor type 22 (lymphoid) , non-receptor type 8 protein tyrosine phosphatase, protein tyrosine phosphatase |
| Synonyms: |
Lyp Lyp1 Lyp2 |
| Locus: |
1p13, 2 |
| Discovery year: |
1999-11-26 |
| GenBank acession: |
AF001846 |
| Entrez gene record: |
26191 |
| Pubmed identfication: |
10068674 1373816 |
| RefSeq identity: |
NM_015967 |
| Classification: |
Protein tyrosine phosphatases, non-receptor type |
| Havana BLAST/BLAT: |
OTTHUMG00000011936 |