PTPN22 Antibody

Contact us
Catalog number: R32361
Price: 573 €
Supplier: genways
Product name: PTPN22 Antibody
Quantity: 1 vial
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PTPN22
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the PTPN22 antibody should be determined by the researcher
Intented use: This PTPN22 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9Y2R2
Purity: Antigen affinity
Description: Alternatively spliced transcript variants encoding distinct isoforms have been described, Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway, This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family, also known as PTPN22, is a protein that in humans is encoded by the PTPN22 gene, non-receptor type 22 (lymphoid), rheumatoid arthritis, systemic lupus erythematosus and Graves' disease, Protein tyrosine phosphatase
Immunogen: Amino acids MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK of human PTPN22 were used as the immunogen for the PTPN22 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PTPN22 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PTPN22
Short name: PTPN22 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: non-receptor classification 22 (lymphoid) (Antibody to), protein tyrosine phosphatase
Alternative technique: antibodies
Alternative to gene target: PTPN22 and IDBG-101222 and ENSG00000134242 and 26191, PTPN22 and IDBG-634891 and ENSBTAG00000019617 and, Ptpn22 and IDBG-181952 and ENSMUSG00000027843 and 19260, kinase binding, non-receptor type 22 (lymphoid), nuclei, this GO :0004725 and protein tyrosine phosphatase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006470 and protein dephosphorylation and biological process this GO :0009898 and cytoplasmic side of plasma membrane and cellular component this GO :0016311 and dephosphorylation and biological process this GO :0016791 and phosphatase activity and molecular function this GO :0017124 and SH3 domain binding and molecular function this GO :0019900 and kinase binding and molecular function this GO :0030217 and T cell differentiation and biological process this GO :0032817 and regulation of natural killer cell proliferation and biological process this GO :0035335 and peptidyl-tyrosine dephosphorylation and biological process this GO :0035644 and phosphoanandamide dephosphorylation and biological process this GO :0045088 and regulation of innate immune response and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050852 and T cell receptor signaling pathway and biological process this GO :0050855 and regulation of B cell receptor signaling pathway and biological process this GO :0050856 and regulation of T cell receptor signaling pathway and biological process this GO :0050860 and negative regulation of T cell receptor signaling pathway and biological process this GO :0050868 and negative regulation of T cell activation and biological process, this GO :0004725 : protein tyrosine phosphatase activity, this GO :0004725 : protein tyrosine phosphatase activity and also this GO :0005515 : protein binding and also this GO :0016791 : phosphatase activity and also this GO :0017124 : SH3 domain binding and also this GO :0019900 : kinase binding, this GO :0005515 : protein binding, this GO :0016791 : phosphatase activity, this GO :0017124 : SH3 domain binding, this GO :0019900 : kinase binding, protein tyrosine phosphatase
Identity: 9652
Gene: PTPN22 | More about : PTPN22
Long gene name: non-receptor type 22 , protein tyrosine phosphatase
Synonyms gene: PTPN8
Synonyms gene name: non-receptor type 22 (lymphoid) , non-receptor type 8 protein tyrosine phosphatase, protein tyrosine phosphatase
Synonyms: Lyp Lyp1 Lyp2
Locus: 1p13, 2
Discovery year: 1999-11-26
GenBank acession: AF001846
Entrez gene record: 26191
Pubmed identfication: 10068674 1373816
RefSeq identity: NM_015967
Classification: Protein tyrosine phosphatases, non-receptor type
Havana BLAST/BLAT: OTTHUMG00000011936

Related Products :

AP23978PU-N anti-PTPN22 (766-780) Antibody 50 Вµg 732 € acr human
A03P0310 anti-PTPN22 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AM31936PU-N anti-PTPN22 Antibody 50 Вµg 819 € acr human
GENTAUR-58be056dde714 Anti- PTPN22 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be056e42ee6 Anti- PTPN22 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be07be4dd88 Anti- PTPN22 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be07be8cbb6 Anti- PTPN22 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be11ec8cc70 Anti- PTPN22 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be11ed0e230 Anti- PTPN22 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be3daa50929 Anti- PTPN22 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be4b40b6772 Anti- PTPN22 Antibody 100ug 370 € MBS Polyclonals human
XW-7837 anti-PTPN22 Antibody 0.05 mg 180 € proscience human
abx146971 Anti-PTPN22 Antibody 200 μg 369 € abbex human
abx147052 Anti-PTPN22 Antibody 100 μg 311 € abbex human
AP53511PU-N anti-PTPN22 (C-term) Antibody 0,4 ml 587 € acr human
MBS243153 Goat Polyclonal to Human PTPN22 / PEP Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bde69953350 Mouse Monoclonal [clone 1A6] (IgG2a,k) to Human PTPN22 / PEP Antibody 50ug 663 € MBS mono human
R32361 PTPN22 Antibody 0.1mg 406 € NJS poly human
YSRTMCA5385Z PTPN22, Mouse Monoclonal antibody-; Clone: 4F6 0.1 mg Ask price € accurate-monoclonals mouse
MBS127647 PTPN22 Polyclonal Antibody 200ug 558 € MBS Polyclonals_1 human
abx930373 Anti-PTPN22 siRNA inquire 50 € abbex human
abx930374 Anti-PTPN22 siRNA 30 nmol 717 € abbex human
MBS614418 Lymphoid-specific Protein Tyrosine Phosphatase Isoform 2 (PTPN22) 50ug 625 € MBS Polyclonals_1 human
LV277813 PTPN22 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-4323A5 PTPN22 Over-expression Lysate reagent 1 x 1 vial 873 € genways human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human
GWB-B43069 antibody to or anti-Apaf1 (Mouse) Monoclonal antibody , antibody 1 vial 573 € genways mouse