ABCG2 Antibody (BCRP)

Contact us
Catalog number: R32353
Price: 387 €
Supplier: MBS Polyclonals
Product name: ABCG2 Antibody (BCRP)
Quantity: 100ug
Other quantities: 0.08 ml 199€ 0.1mg 389€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ABCG2 (BCRP)
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-F, IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the BCRP antibody should be determined by the researcher
Intented use: This BCRP antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q9UNQ0
Purity: Antigen affinity
Description: (2001) concluded that ABCG2 is likely functioning as a homodimer or homooligomer in this expression system since it is unlikely that putative Sf9 transport partners would be overexpressed at similarly high levels, ABCG2 is a major factor in the concentrative transfer of drugs, BCRP or MRX, In vitro assays of isolated membrane preparations revealed a high-capacity, Ozvegy et al, The ABCG2 gene encodes a membrane transporter belonging to the ATP-binding cassette (ABC) superfamily of membrane transporters, The ABCG2 gene is mapped on 4q22, The ABCG2 protein is also a high capacity transporter for uric acid excretion in the kidney, and dietary toxins to the milk of mice, and gut, and humans, carcinogens, cows, is a protein that in humans is encoded by the ABCG2 gene, liver, member 2) also known as ABCP, subfamily g, vanadate-sensitive ATPase activity associated with ABCG2 expression that was stimulated by compounds known to be transported by this protein, which are involved in the trafficking of biologic molecules across cell membranes, which occurs in various plant-derived foods and food supplements and is highly efficient in limiting its uptake from ingested food, 1, ABCG2(Atp-binding cassette, Abcg2 transports pheophorbide-a
Immunogen: Amino acids RENLQFSAALRLATTMTNHEKNERINRVIQEL of human ABCG2 were used as the immunogen for the BCRP antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the BCRP antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ABCG2 (BCRP)
Short name: ABCG2 Antibody (BCRP)
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: ABCG2 (Antibody to) (BCRP)
Alternative technique: antibodies
Identity: 74
Gene: ABCG2 | More about : ABCG2
Long gene name: ATP binding cassette subfamily G member 2 (Junior blood group)
Synonyms gene name: ATP-binding cassette, member 2 (Junior blood group) , member 2 ATP-binding cassette, sub-family G (WHITE), sub-family G (WHITE)
Synonyms: EST157481 MXR BCRP ABCP CD338
Locus: 4q22, 1
Discovery year: 1999-10-26
GenBank acession: AF103796
Entrez gene record: 9429
Pubmed identfication: 8894702 9861027
RefSeq identity: NM_004827
Classification: CD molecules Blood group antigens ATP binding cassette subfamily G
Havana BLAST/BLAT: OTTHUMG00000130601
Locus Specific Databases: LRG_823

Related Products :

F44284-0.08ML ABCG2 Antibody (BCRP) 0.08 ml 199 € NJS poly human
R30968 ABCG2 Antibody (BCRP) 0.1mg 389 € NJS poly human
R30969 ABCG2 Antibody (BCRP) 0.1mg 389 € NJS poly human
R32353 ABCG2 Antibody (BCRP) 0.1mg 406 € NJS poly human
YM9037 Breast Cancer Protein (BCRP), ABCG2, Clone: BXP-34, Mouse Monoclonal antibody- 1000ul 978 € accurate-monoclonals mouse
OBT1177 Breast Cancer Resistance Protein (BCRP), ABCG2, Clone: BXP-21, Mouse Monoclonal antibody-Human; frozen/paraffin, IH/WB 1000ul 1175 € accurate-monoclonals human
YM9051 Breast Cancer Resistance Protein (Bcrp), Abcg2, Clone: BXP-53, Mouse Monoclonal antibody- 1000ul 978 € accurate-monoclonals mouse
YM9050 Breast Cancer Resistance Protein (Bcrp), Abcg2, Clone: BXP-9, Mouse Monoclonal antibody- 1000ul 978 € accurate-monoclonals mouse
MBS423293 Goat anti-ABCG2 / BCRP Antibody 100ug 370 € MBS Polyclonals_1 human
GWB-5DDE5B BCRP antibody 1 tube 591 € genways human
GWB-786A9F BCRP antibody 1 tube 532 € genways human
YM9041 Breast Cancer Protein (BCRP), Clone: BXP-21, Mouse Monoclonal antibody- 1000ul 978 € accurate-monoclonals mouse
F44284-0.4ML ABCG2 Antibody 0.4 ml 406 € NJS poly human
GENTAUR-58be41c6bb124 ABCG2 Antibody 100ug 370 € MBS mono human
GENTAUR-58be43f5c6e1e ABCG2 Antibody 100ul 370 € MBS mono human
GENTAUR-58be47edc206e ABCG2 Antibody 100ug 370 € MBS mono human
GENTAUR-58bdf7ac70d4b Anti- ABCG2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf7accb701 Anti- ABCG2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be067980ce9 Anti- ABCG2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0679df782 Anti- ABCG2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be15f497637 Anti- ABCG2 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be15f50c58d Anti- ABCG2 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be418edebd0 Anti- ABCG2 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be453f76408 Anti- ABCG2 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be4775a4895 Anti- ABCG2 Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be4a4c0d6eb Anti- ABCG2 Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be4f921e559 Anti- ABCG2 Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be4f927af0f Anti- ABCG2 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be4f92dd818 Anti- ABCG2 Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be575bd0fd9 Anti- ABCG2 Antibody 100ug 387 € MBS Polyclonals human