| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
ABCG2 (BCRP) |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-F, IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the BCRP antibody should be determined by the researcher |
| Intented use: |
This BCRP antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q9UNQ0 |
| Purity: |
Antigen affinity |
| Description: |
(2001) concluded that ABCG2 is likely functioning as a homodimer or homooligomer in this expression system since it is unlikely that putative Sf9 transport partners would be overexpressed at similarly high levels, ABCG2 is a major factor in the concentrative transfer of drugs, BCRP or MRX, In vitro assays of isolated membrane preparations revealed a high-capacity, Ozvegy et al, The ABCG2 gene encodes a membrane transporter belonging to the ATP-binding cassette (ABC) superfamily of membrane transporters, The ABCG2 gene is mapped on 4q22, The ABCG2 protein is also a high capacity transporter for uric acid excretion in the kidney, and dietary toxins to the milk of mice, and gut, and humans, carcinogens, cows, is a protein that in humans is encoded by the ABCG2 gene, liver, member 2) also known as ABCP, subfamily g, vanadate-sensitive ATPase activity associated with ABCG2 expression that was stimulated by compounds known to be transported by this protein, which are involved in the trafficking of biologic molecules across cell membranes, which occurs in various plant-derived foods and food supplements and is highly efficient in limiting its uptake from ingested food, 1, ABCG2(Atp-binding cassette, Abcg2 transports pheophorbide-a |
| Immunogen: |
Amino acids RENLQFSAALRLATTMTNHEKNERINRVIQEL of human ABCG2 were used as the immunogen for the BCRP antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the BCRP antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
ABCG2 (BCRP) |
| Short name: |
ABCG2 Antibody (BCRP) |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
ABCG2 (Antibody to) (BCRP) |
| Alternative technique: |
antibodies |
| Identity: |
74 |
| Gene: |
ABCG2 |
More about : ABCG2 |
| Long gene name: |
ATP binding cassette subfamily G member 2 (Junior blood group) |
| Synonyms gene name: |
ATP-binding cassette, member 2 (Junior blood group) , member 2 ATP-binding cassette, sub-family G (WHITE), sub-family G (WHITE) |
| Synonyms: |
EST157481 MXR BCRP ABCP CD338 |
| Locus: |
4q22, 1 |
| Discovery year: |
1999-10-26 |
| GenBank acession: |
AF103796 |
| Entrez gene record: |
9429 |
| Pubmed identfication: |
8894702 9861027 |
| RefSeq identity: |
NM_004827 |
| Classification: |
CD molecules Blood group antigens ATP binding cassette subfamily G |
| Havana BLAST/BLAT: |
OTTHUMG00000130601 |
| Locus Specific Databases: |
LRG_823 |