| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
TSG101 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the TSG101 antibody should be determined by the researcher |
| Intented use: |
This TSG101 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q99816 |
| Purity: |
Antigen affinity |
| Description: |
And the protein may play a role in cell growth and differentiation and act as a negative growth regulator, In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation, Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression, The gene product contains a coiled-coil domain that interacts with stathmin, The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes, a cytosolic phosphoprotein implicated in tumorigenesis, is mapped to 11p15, known as Tumor susceptibility gene 101, TSG101 |
| Immunogen: |
Amino acids KHVRLLSRKQFQLRALMQKARKTAGLSDLY of human TSG101 were used as the immunogen for the TSG101 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TSG101 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
TSG101 |
| Short name: |
TSG101 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
TSG101 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
15971 |
| Gene: |
TSG101 |
More about : TSG101 |
| Long gene name: |
tumor susceptibility 101 |
| Synonyms gene: |
TSG10 |
| Synonyms gene name: |
tumor susceptibility gene 10 tumor susceptibility gene 101 |
| Synonyms: |
VPS23 |
| Locus: |
11p15, 1 |
| Discovery year: |
2001-07-20 |
| GenBank acession: |
U82130 |
| Entrez gene record: |
7251 |
| Pubmed identfication: |
9019400 9241264 |
| RefSeq identity: |
NM_006292 |
| Classification: |
ESCRT-I |
| Havana BLAST/BLAT: |
OTTHUMG00000167725 |