TSG101 Antibody

Contact us
Catalog number: R32315
Price: 717 €
Supplier: abbex
Product name: TSG101 Antibody
Quantity: 30 nmol
Other quantities: 0.08 ml 199€ 0.1ml 263€ 0.4 ml 406€ 1 tube 411€ 1 x 1 vial 411€ 100ug 370€ 100ul 426€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: TSG101
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the TSG101 antibody should be determined by the researcher
Intented use: This TSG101 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q99816
Purity: Antigen affinity
Description: And the protein may play a role in cell growth and differentiation and act as a negative growth regulator, In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation, Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression, The gene product contains a coiled-coil domain that interacts with stathmin, The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes, a cytosolic phosphoprotein implicated in tumorigenesis, is mapped to 11p15, known as Tumor susceptibility gene 101, TSG101
Immunogen: Amino acids KHVRLLSRKQFQLRALMQKARKTAGLSDLY of human TSG101 were used as the immunogen for the TSG101 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the TSG101 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: TSG101
Short name: TSG101 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: TSG101 (Antibody to)
Alternative technique: antibodies
Identity: 15971
Gene: TSG101 | More about : TSG101
Long gene name: tumor susceptibility 101
Synonyms gene: TSG10
Synonyms gene name: tumor susceptibility gene 10 tumor susceptibility gene 101
Synonyms: VPS23
Locus: 11p15, 1
Discovery year: 2001-07-20
GenBank acession: U82130
Entrez gene record: 7251
Pubmed identfication: 9019400 9241264
RefSeq identity: NM_006292
Classification: ESCRT-I
Havana BLAST/BLAT: OTTHUMG00000167725

Related Products :

GENTAUR-58bd682ed4130 Dictyostelium discoideum ESCRT-I complex subunit tsg101 (tsg101) 100ug 2326 € MBS Recombinant Proteins human
GENTAUR-58bd682f36764 Dictyostelium discoideum ESCRT-I complex subunit tsg101 (tsg101) 1000ug 2326 € MBS Recombinant Proteins human
GENTAUR-58bd682f7d3d9 Dictyostelium discoideum ESCRT-I complex subunit tsg101 (tsg101) 100ug 2840 € MBS Recombinant Proteins human
GENTAUR-58bd682fb616d Dictyostelium discoideum ESCRT-I complex subunit tsg101 (tsg101) 1000ug 2840 € MBS Recombinant Proteins human
AR09431PU-L anti-TSG101 (1-145, His-tag) Antibody 0,25 mg 1500 € acr human
AR09431PU-N anti-TSG101 (1-145, His-tag) Antibody 50 Вµg 587 € acr human
AM31014PU-N anti-TSG101 (201-281) Antibody 50 Вµg 819 € acr human
AP20455PU-N anti-TSG101 Antibody 0,1 mg 558 € acr human
GENTAUR-58be3c53a2da6 Anti- TSG101 Antibody 100ug 393 € MBS Polyclonals human
abx219155 Anti-TSG101 Antibody 100 μg 311 € abbex human
AP12056PU-N anti-TSG101 (C-term) Antibody 0,4 ml 587 € acr human
AP12055PU-N anti-TSG101 (N-term) Antibody 0,4 ml 587 € acr human
GENTAUR-58bde71564417 Mouse Monoclonal [clone 5B7] (IgG2a,k) to Human TSG101 Antibody 50ug 663 € MBS mono human
F47989-0.08ML TSG101 Antibody 0.08 ml 199 € NJS poly human
F47989-0.4ML TSG101 Antibody 0.4 ml 406 € NJS poly human
F47990-0.08ML TSG101 Antibody 0.08 ml 199 € NJS poly human
F47990-0.4ML TSG101 Antibody 0.4 ml 406 € NJS poly human
GWB-2D9796 TSG101 antibody 1 x 1 vial 411 € genways human
GWB-543766 TSG101 antibody 1 x 1 vial 411 € genways human
GWB-58DFA4 TSG101 antibody 1 x 1 vial 486 € genways human
GWB-66AEF3 TSG101 antibody 1 tube 411 € genways human
MBS271167 TSG101 antibody 100ul 426 € MBS Polyclonals_1 human
MBS852239 TSG101 Antibody 100ug 370 € MBS Polyclonals_1 human
R32315 TSG101 Antibody 0.1mg 406 € NJS poly human
bs-1365R Tsg101 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
ENZ-007251-M01 TSG101 Mouse Monoclonal Antibody (M01), clone 5B7 0.1mg 495 € Zyagen mouse
MBS126289 TSG101 Polyclonal Antibody 50ug 365 € MBS Polyclonals_1 human
abx153403 Anti-Human TSG101 ELISA Kit inquire 50 € abbex human
abx572890 Anti-Human TSG101 ELISA Kit inquire 50 € abbex human
abx905826 Anti-TSG101 siRNA 30 nmol 717 € abbex human