RENT1 / hUPF1 Antibody

Contact us
Catalog number: R32296
Price: 1041 €
Supplier: genways
Product name: RENT1 / hUPF1 Antibody
Quantity: 1 vial
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: RENT1 / hUPF1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the UPF1 antibody should be determined by the researcher
Intented use: This UPF1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q92900
Purity: Antigen affinity
Description: Alternative splicing results in multiple transcript variants, And this protein is located only in the cytoplasm, This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance, Use of multiple polyadenylation sites has been noted for this gene, When translation ends, When translation ends upstream from the last exon-exon junction, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping, mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD), this triggers NMD to degrade mRNAs containing premature stop codons, Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene
Immunogen: Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE of human UPF1 were used as the immunogen for the UPF1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UPF1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: RENT1 / hUPF1
Short name: RENT1 / hUPF1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: RENT1 / hUPF1 (Antibody to)
Alternative technique: antibodies
Identity: 9962
Gene: UPF1 | More about : UPF1
Long gene name: RNA helicase and ATPase , UPF1
Synonyms gene: RENT1
Synonyms gene name: regulator of nonsense transcripts 1 UPF1 regulator of nonsense transcripts homolog (yeast)
Synonyms: HUPF1 KIAA0221 NORF1 pNORF1 smg-2
Synonyms name: UP Frameshift 1 smg-2 homolog, elegans) , nonsense mediated mRNA decay factor (C
Locus: 19p13, 11
Discovery year: 1997-02-11
GenBank acession: AF074016
Entrez gene record: 5976
Pubmed identfication: 8855285 9064659
RefSeq identity: NM_002911
Classification: UPF1 like RNA helicases
Havana BLAST/BLAT: OTTHUMG00000183025

Related Products :

MBS612156 RENT1 (Regulator of Nonsense Transcripts 1, ATP-dependent Helicase RENT1, Delta Helicase, FLJ43809, FLJ46894, HUPF1, KIAA0221, Nonsense mRNA Reducing Factor 1, NORF1, pNORF1, pNORF-1, UP Frameshift 1, UPF1, Up Frameshift Mutation 1 Homolog (S. cerevisiae) 100ug 785 € MBS Polyclonals_1 human
R32296 RENT1 / hUPF1 Antibody 0.1mg 406 € NJS poly human
bs-8565R-A350 RENT1/hUPF1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8565R-A488 RENT1/hUPF1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8565R-A555 RENT1/hUPF1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8565R-A594 RENT1/hUPF1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8565R-A647 RENT1/hUPF1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-8565R-Biotin RENT1/hUPF1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-8565R RENT1/hUPF1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-8565R-Cy3 RENT1/hUPF1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8565R-Cy5 RENT1/hUPF1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8565R-Cy5.5 RENT1/hUPF1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8565R-Cy7 RENT1/hUPF1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-8565R-FITC RENT1/hUPF1 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-8565R-HRP RENT1/hUPF1 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
GENTAUR-58be6692c7339 Anti-RENT1/hUPF1 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
MBS623606 RENT1, NT (Regulator of Nonsense Transcripts 1, ATP-dependent Helicase RENT1, Nonsense mRNA Reducing Factor 1, NORF1, Up-frameshift Suppressor 1 Homolog, hUpf1, KIAA0221, UPF1) 200ul 603 € MBS Polyclonals_1 human
C18329-1 anti-UPF1 / RENT1 Antibody 50 Вµg 347 € acr human
C18329-2 anti-UPF1 / RENT1 Antibody 0,1 mg 500 € acr human
AP11687PU-N anti-UPF1 / RENT1 (N-term) Antibody 0,4 ml 587 € acr human
GWB-D4BCF0 RENT1 antibody 1 vial 591 € genways human
MBS272906 RENT1 antibody [N1N2], N-term 100ul 426 € MBS Polyclonals_1 human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human
GWB-B43069 antibody to or anti-Apaf1 (Mouse) Monoclonal antibody , antibody 1 vial 573 € genways mouse
GWB-A68C2D antibody to or anti- Brain-specificity angiogenesis inhibitor 2 antibody to or anti-Human antibody 1 vial 602 € genways human
GWB-6B2DC9 antibody to or anti- Control Immune Serum goat antibody to or anti- peptide sequence Carrier antibody 1 tube 729 € genways human
GWB-BE9688 antibody to or anti- Estrone-6 antibody antibody 1 vial 1041 € genways human