| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
RENT1 / hUPF1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the UPF1 antibody should be determined by the researcher |
| Intented use: |
This UPF1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
Q92900 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in multiple transcript variants, And this protein is located only in the cytoplasm, This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance, Use of multiple polyadenylation sites has been noted for this gene, When translation ends, When translation ends upstream from the last exon-exon junction, it interacts with the protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping, mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD), this triggers NMD to degrade mRNAs containing premature stop codons, Regulator of nonsense transcripts 1 is a protein that in humans is encoded by the UPF1 gene |
| Immunogen: |
Amino acids NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE of human UPF1 were used as the immunogen for the UPF1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UPF1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
RENT1 / hUPF1 |
| Short name: |
RENT1 / hUPF1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
RENT1 / hUPF1 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
9962 |
| Gene: |
UPF1 |
More about : UPF1 |
| Long gene name: |
RNA helicase and ATPase , UPF1 |
| Synonyms gene: |
RENT1 |
| Synonyms gene name: |
regulator of nonsense transcripts 1 UPF1 regulator of nonsense transcripts homolog (yeast) |
| Synonyms: |
HUPF1 KIAA0221 NORF1 pNORF1 smg-2 |
| Synonyms name: |
UP Frameshift 1 smg-2 homolog, elegans) , nonsense mediated mRNA decay factor (C |
| Locus: |
19p13, 11 |
| Discovery year: |
1997-02-11 |
| GenBank acession: |
AF074016 |
| Entrez gene record: |
5976 |
| Pubmed identfication: |
8855285 9064659 |
| RefSeq identity: |
NM_002911 |
| Classification: |
UPF1 like RNA helicases |
| Havana BLAST/BLAT: |
OTTHUMG00000183025 |