ASPH Antibody

Contact us
Catalog number: R32203
Price: 50 €
Supplier: abbex
Product name: ASPH Antibody
Quantity: inquire
Other quantities: 1 tube 411€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ASPH
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the ASPH antibody should be determined by the researcher
Intented use: This ASPH antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: Q12797
Purity: Antigen affinity
Description: And the gene is expressed from two promoters and undergoes extensive alternative splicing, IX, Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, Some isoforms have been implicated in metastasis, Some of these isoforms are found in complexes with calsequestrin, The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties, The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, This gene is thought to play an important role in calcium homeostasis, and X, and have been shown to regulate calcium release from the sarcoplasmic reticulum, and some have been localized to the endoplasmic and sarcoplasmic reticulum, and the complement factors C1R and C1S, and the ryanodine receptor, coagulation factors VII, including protein C, triadin, ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase or aspartate beta-hydroxylase
Immunogen: Amino acids EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI of human ASPH were used as the immunogen for the ASPH antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ASPH antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ASPH
Short name: ASPH Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: ASPH (Antibody to)
Alternative technique: antibodies
Identity: 757
Gene: ASPH | More about : ASPH
Long gene name: aspartate beta-hydroxylase
Synonyms: CASQ2BP1 BAH JCTN HAAH
Synonyms name: junctin humbug junctate
Locus: 8q12, 3
Discovery year: 1995-06-13
GenBank acession: AF224468
Entrez gene record: 444
Pubmed identfication: 7821814 10974562
RefSeq identity: NM_004318
Havana BLAST/BLAT: OTTHUMG00000164375

Related Products :

AR09383PU-L anti-ASPH (75-270, His-tag) Antibody 0,5 mg 1500 € acr human
AR09383PU-N anti-ASPH (75-270, His-tag) Antibody 0,1 mg 587 € acr human
GENTAUR-58bdf3665337f Anti- ASPH Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf366aaa0f Anti- ASPH Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be51955056e Anti- ASPH Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be5195c8a9d Anti- ASPH Antibody 0.2 mg 558 € MBS Polyclonals human
GENTAUR-58be519632fcb Anti- ASPH Antibody 100ug 387 € MBS Polyclonals human
AP50276PU-N anti-ASPH (Center) Antibody 0,4 ml 587 € acr human
GWB-7D7063 ASPH antibody 1 tube 411 € genways human
GWB-ML787D ASPH antibody 1 vial 521 € genways human
GWB-ML924F ASPH antibody 1 vial 521 € genways human
GWB-MM771F ASPH antibody 1 vial 521 € genways human
GWB-MS232G ASPH antibody 1 vial 521 € genways human
GWB-MS233H ASPH antibody 1 vial 440 € genways human
R32203 ASPH Antibody 0.1mg 406 € NJS poly human
bs-12137R-A350 ASPH/Aspartate beta hydroxylase Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12137R-A488 ASPH/Aspartate beta hydroxylase Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12137R-A555 ASPH/Aspartate beta hydroxylase Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12137R-A594 ASPH/Aspartate beta hydroxylase Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12137R-A647 ASPH/Aspartate beta hydroxylase Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-12137R-Biotin ASPH/Aspartate beta hydroxylase Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-12137R ASPH/Aspartate beta hydroxylase Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-12137R-Cy3 ASPH/Aspartate beta hydroxylase Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-12137R-Cy5 ASPH/Aspartate beta hydroxylase Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-12137R-Cy5.5 ASPH/Aspartate beta hydroxylase Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-12137R-Cy7 ASPH/Aspartate beta hydroxylase Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-12137R-FITC ASPH/Aspartate beta hydroxylase Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-12137R-HRP ASPH/Aspartate beta hydroxylase Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
GENTAUR-58be5c2997563 Anti-ASPH/Aspartate beta hydroxylase, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx908371 Anti-ASPH siRNA inquire 50 € abbex human