MUNC18-1 Antibody / STXBP1

Contact us
Catalog number: R32158
Price: 348 €
Supplier: MBS Polyclonals
Product name: MUNC18-1 Antibody / STXBP1
Quantity: 0.12 ml
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: MUNC18-1 / STXBP1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the MUNC18-1 antibody should be determined by the researcher
Intented use: This MUNC18-1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P61764
Purity: Antigen affinity
Description: Alternatively spliced transcript variants have been described, By fluorescence in situ hybridization, Mutations in this gene have been associated with infantile epileptic encephalopathy-4, The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, This gene encodes a syntaxin-binding protein, a transmembrane attachment protein receptor, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene, the STXBP1 gene is mapped to chromosome 9q34, 1, Syntaxin-binding protein 1
Immunogen: Amino acids KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD of human MUNC18-1 were used as the immunogen for the MUNC18-1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MUNC18-1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: membranous, Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: MUNC18-1 / STXBP1
Short name: MUNC18-1 Antibody / STXBP1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: MUNC18-1 (Antibody to) / syntaxin binding protein 1
Alternative technique: antibodies
Alternative to gene target: GABAergic and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043234 and protein complex and cellular component this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045921 and positive regulation of exocytosis and biological process this GO :0045956 and positive regulation of calcium ion-dependent exocytosis and biological process this GO :0047485 and protein N-terminus binding and molecular function this GO :0050796 and regulation of insulin secretion and biological process this GO :0050821 and protein stabilization and biological process this GO :0060292 and long term synaptic depression and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070527 and platelet aggregation and biological process, MUNC18-1 and NSEC1 and P67 and RBSEC1 and UNC18, Plasma membranes, STXBP1 and IDBG-638972 and ENSBTAG00000003525 and 282378, STXBP1 and IDBG-86143 and ENSG00000136854 and 6812, Stxbp1 and IDBG-161623 and ENSMUSG00000026797 and 20910, protein N-terminus binding, this GO :0000149 and SNARE binding and molecular function this GO :0002576 and platelet degranulation and biological process this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006112 and energy reserve metabolic process and biological process this GO :0006887 and exocytosis and biological process this GO :0006904 and vesicle docking involved in exocytosis and biological process this GO :0007268 and synaptic transmission and biological process this GO :0007269 and neurotransmitter secretion and biological process this GO :0007274 and neuromuscular synaptic transmission and biological process this GO :0007412 and axon target recognition and biological process this GO :0010807 and regulation of synaptic vesicle priming and biological process this GO :0014047 and glutamate secretion and biological process this GO :0015031 and protein transport and biological process this GO :0016188 and synaptic vesicle maturation and biological process this GO :0016192 and vesicle-mediated transport and biological process this GO :0017075 and syntaxin-1 binding and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0019904 and protein domain specific binding and molecular function this GO :0019905 and syntaxin binding and molecular function this GO :0031091 and platelet alpha granule and cellular component this GO :0032229 and negative regulation of synaptic transmission, this GO :0000149 : SNARE binding, this GO :0000149 : SNARE binding and also this GO :0005515 : protein binding and also this GO :0017075 : syntaxin-1 binding and also this GO :0019901 : protein kinase binding and also this GO :0019904 : protein domain specific binding and also this GO :0019905 : syntaxin binding and also this GO :0042802 : identical protein binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0047485 : protein N-terminus binding, this GO :0005515 : protein binding, this GO :0017075 : syntaxin-1 binding, this GO :0019901 : protein kinase binding, this GO :0019904 : protein domain specific binding, this GO :0019905 : syntaxin binding, this GO :0042802 : identical protein binding, this GO :0044822 : poly(A) RNA binding, this GO :0047485 : protein N-terminus binding, syntaxin binding protein 1
Identity: 11444
Gene: STXBP1 | More about : STXBP1
Long gene name: syntaxin binding protein 1
Synonyms: hUNC18 MUNC18-1 UNC18 rbSec1
Synonyms name: syntaxin-binding protein 1
Locus: 9q34, 11
Discovery year: 1996-12-27
GenBank acession: AF004563
Entrez gene record: 6812
Pubmed identfication: 9545644
RefSeq identity: NM_003165
Havana BLAST/BLAT: OTTHUMG00000020713

Related Products :

MBS618089 Munc-18, phosphorylated (Ser515) (Mammalian Homolog of Unc-18, Munc18, hUNC18, Munc18-1, Munc18a, N-Sec1, p67, Rbsec1, Syntaxin Binding Protein 1, STXBP1, UNC18, UNC-18, Unc18 Homolog, Unc-18 Homolog, Unc 18-1, Unc-18-1, Unc18A, Unc-18A) Antibody 100ul 713 € MBS Polyclonals_1 human
MBS420125 Goat anti-MUNC18 / STXBP1 (isoform a) Antibody 100ug 370 € MBS Polyclonals_1 human
MBS244985 Goat Polyclonal to Human STXBP1 / Munc18 / p67 Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bde7ea64254 Mouse Monoclonal [clone 6D1] (IgG2a,k) to Human STXBP1 / Munc18 / p67 Antibody 50ug 663 € MBS mono human
R32158 MUNC18-1 Antibody / STXBP1 0.1mg 406 € NJS poly human
bs-3954R-A350 STXBP1/Munc18 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3954R-A488 STXBP1/Munc18 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3954R-A555 STXBP1/Munc18 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3954R-A594 STXBP1/Munc18 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3954R-A647 STXBP1/Munc18 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-3954R-Biotin STXBP1/Munc18 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-3954R STXBP1/Munc18 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-3954R-Cy3 STXBP1/Munc18 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-3954R-Cy5 STXBP1/Munc18 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-3954R-Cy5.5 STXBP1/Munc18 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-3954R-Cy7 STXBP1/Munc18 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-3954R-FITC STXBP1/Munc18 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-3954R-HRP STXBP1/Munc18 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
GENTAUR-58be623e4604c Anti-STXBP1/Munc18 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
MBS243188 PAb (IgG) to Human STXBP1 / Munc18 / p67 50ug 597 € MBS Polyclonals_1 human
R36062-100UG MUNC18-1 Antibody 0.1mg 406 € NJS poly human
MBS620026 MUNC18-2 (Syntaxin-binding Protein 2, Syntaxin-BP2, STXBP2, Hunc18b, Unc18-2) Antibody 100ug 774 € MBS Polyclonals_1 human
R35945-100UG MUNC18-3 Antibody 0.1mg 406 € NJS poly human
GENTAUR-58be26d6c01ec Anti-Human Munc18-1(STXBP1), Biotin, (clone: 1B9) (Mouse IgG2b, k) 100ug 343 € MBS mono mouse
GENTAUR-58be26d0df5d7 Anti-Human Munc18-1(STXBP1), HRPO, (clone: 1B9) (Mouse IgG2b, k) 100ug 404 € MBS mono mouse
GENTAUR-58be26ac7fdef Anti-Human Munc18-1(STXBP1), Purified, (clone: 1B9) (Mouse IgG2b, k) 200ug 415 € MBS mono mouse
MBS620460 Syntaxin-binding protein 1 (Syntaxin-BP1, p67, Munc18-1, N-Sec1, Unc18A) 100ug 774 € MBS Polyclonals_1 human
GENTAUR-58bde9a489e64 Anti- STXBP1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bde9a4de0a4 Anti- STXBP1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf14d5d3fd Anti- STXBP1 Antibody 0.12 ml 348 € MBS Polyclonals human