| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MUNC18-1 / STXBP1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the MUNC18-1 antibody should be determined by the researcher |
| Intented use: |
This MUNC18-1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P61764 |
| Purity: |
Antigen affinity |
| Description: |
Alternatively spliced transcript variants have been described, By fluorescence in situ hybridization, Mutations in this gene have been associated with infantile epileptic encephalopathy-4, The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, This gene encodes a syntaxin-binding protein, a transmembrane attachment protein receptor, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene, the STXBP1 gene is mapped to chromosome 9q34, 1, Syntaxin-binding protein 1 |
| Immunogen: |
Amino acids KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD of human MUNC18-1 were used as the immunogen for the MUNC18-1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MUNC18-1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
membranous, Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MUNC18-1 / STXBP1 |
| Short name: |
MUNC18-1 Antibody / STXBP1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
MUNC18-1 (Antibody to) / syntaxin binding protein 1 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
GABAergic and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043234 and protein complex and cellular component this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0045921 and positive regulation of exocytosis and biological process this GO :0045956 and positive regulation of calcium ion-dependent exocytosis and biological process this GO :0047485 and protein N-terminus binding and molecular function this GO :0050796 and regulation of insulin secretion and biological process this GO :0050821 and protein stabilization and biological process this GO :0060292 and long term synaptic depression and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070527 and platelet aggregation and biological process, MUNC18-1 and NSEC1 and P67 and RBSEC1 and UNC18, Plasma membranes, STXBP1 and IDBG-638972 and ENSBTAG00000003525 and 282378, STXBP1 and IDBG-86143 and ENSG00000136854 and 6812, Stxbp1 and IDBG-161623 and ENSMUSG00000026797 and 20910, protein N-terminus binding, this GO :0000149 and SNARE binding and molecular function this GO :0002576 and platelet degranulation and biological process this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006112 and energy reserve metabolic process and biological process this GO :0006887 and exocytosis and biological process this GO :0006904 and vesicle docking involved in exocytosis and biological process this GO :0007268 and synaptic transmission and biological process this GO :0007269 and neurotransmitter secretion and biological process this GO :0007274 and neuromuscular synaptic transmission and biological process this GO :0007412 and axon target recognition and biological process this GO :0010807 and regulation of synaptic vesicle priming and biological process this GO :0014047 and glutamate secretion and biological process this GO :0015031 and protein transport and biological process this GO :0016188 and synaptic vesicle maturation and biological process this GO :0016192 and vesicle-mediated transport and biological process this GO :0017075 and syntaxin-1 binding and molecular function this GO :0019901 and protein kinase binding and molecular function this GO :0019904 and protein domain specific binding and molecular function this GO :0019905 and syntaxin binding and molecular function this GO :0031091 and platelet alpha granule and cellular component this GO :0032229 and negative regulation of synaptic transmission, this GO :0000149 : SNARE binding, this GO :0000149 : SNARE binding and also this GO :0005515 : protein binding and also this GO :0017075 : syntaxin-1 binding and also this GO :0019901 : protein kinase binding and also this GO :0019904 : protein domain specific binding and also this GO :0019905 : syntaxin binding and also this GO :0042802 : identical protein binding and also this GO :0044822 : poly(A) RNA binding and also this GO :0047485 : protein N-terminus binding, this GO :0005515 : protein binding, this GO :0017075 : syntaxin-1 binding, this GO :0019901 : protein kinase binding, this GO :0019904 : protein domain specific binding, this GO :0019905 : syntaxin binding, this GO :0042802 : identical protein binding, this GO :0044822 : poly(A) RNA binding, this GO :0047485 : protein N-terminus binding, syntaxin binding protein 1 |
| Identity: |
11444 |
| Gene: |
STXBP1 |
More about : STXBP1 |
| Long gene name: |
syntaxin binding protein 1 |
| Synonyms: |
hUNC18 MUNC18-1 UNC18 rbSec1 |
| Synonyms name: |
syntaxin-binding protein 1 |
| Locus: |
9q34, 11 |
| Discovery year: |
1996-12-27 |
| GenBank acession: |
AF004563 |
| Entrez gene record: |
6812 |
| Pubmed identfication: |
9545644 |
| RefSeq identity: |
NM_003165 |
| Havana BLAST/BLAT: |
OTTHUMG00000020713 |