| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PPT1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the PPT1 antibody should be determined by the researcher |
| Intented use: |
This PPT1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P50897 |
| Purity: |
Antigen affinity |
| Description: |
Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, PPT-1 is a member of the palmitoyl protein thioesterase family, The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues, The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation, Two transcript variants encoding different isoforms have been found for this gene, also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4), Palmitoyl-protein thioesterase 1 (PPT-1) |
| Immunogen: |
Amino acids KEDVYRNHSIFLADINQERGINESYKKNLMALKK of human PPT1 were used as the immunogen for the PPT1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PPT1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PPT1 |
| Short name: |
PPT1 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
palmitoyl-protein thioesterase 1 (Antibody to) |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BT, CLN1 and INCL and PPT, PPT1 and IDBG-96867 and ENSG00000131238 and 5538, Ppt1 and IDBG-184539 and ENSMUSG00000028657 and 19063, nuclei, palmitoyl-CoA hydrolase activity, this GO :0002084 and protein depalmitoylation and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005764 and lysosome and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005829 and cytosol and cellular component this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006464 and cellular protein modification process and biological process this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0006907 and pinocytosis and biological process this GO :0007040 and lysosome organization and biological process this GO :0007042 and lysosomal lumen acidification and biological process this GO :0007269 and neurotransmitter secretion and biological process this GO :0007399 and nervous system development and biological process this GO :0007420 and brain development and biological process this GO :0007601 and visual perception and biological process this GO :0007625 and grooming behavior and biological process this GO :0008021 and synaptic vesicle and cellular component this GO :0008306 and associative learning and biological process this GO :0008344 and adult locomotory behavior and biological process this GO :0008474 and palmitoyl-(protein) hydrolase activity and molecular function this GO :0015031 and protein transport and biological process this GO :0016020 and membrane and cellular component this GO :0016042 and lipid catabolic process and biological process this GO :0016290 and palmitoyl-CoA hydrolase activity and molecular function this GO :0030149 and sphin this GO lipid catabolic process and biological process this GO :0030163 and protein catabolic process and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030424 and axon and cellular component this GO :0030425 and dendrite and cellular component this GO :0031579 and membrane raft organization and biological process this GO :0032429 and regulation of phospholipase A2 activity and biological process this GO :0043005 and neuron projection and cellular component this GO :0043025 and neuronal cell body and cellular component this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044257 and cellular protein catabolic process and biological process this GO :0044265 and cellular macromolecule catabolic process and biological process this GO :0045121 and membrane raft and cellular component this GO :0045202 and synapse and cellular component this GO :0048260 and positive regulation of receptor-mediated endocytosis and biological process this GO :0048549 and positive regulation of pinocytosis and biological process this GO :0048666 and neuron development and biological process this GO :0050803 and regulation of synapse structure and activity and biological process this GO :0051181 and cofactor transport and biological process this GO :0051186 and cofactor metabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0008474 : palmitoyl-(protein) hydrolase activity, this GO :0008474 : palmitoyl-(protein) hydrolase activity and also this GO :0016290 : palmitoyl-CoA hydrolase activity, this GO :0016290 : palmitoyl-CoA hydrolase activity, 101768 and IDBG-640822 and ENSBTAG00000013367 and 281421, palmitoyl-protein thioesterase 1 |
| Identity: |
9325 |
| Gene: |
PPT1 |
More about : PPT1 |
| Long gene name: |
palmitoyl-protein thioesterase 1 |
| Synonyms gene: |
PPT |
| Synonyms: |
CLN1 INCL |
| Synonyms name: |
ceroid-lipofuscinosis, infantile , neuronal 1 |
| Locus: |
1p34, 2 |
| Discovery year: |
2000-06-09 |
| GenBank acession: |
U44772 |
| Entrez gene record: |
5538 |
| Pubmed identfication: |
7637805 8325646 |
| RefSeq identity: |
NM_000310 |
| Havana BLAST/BLAT: |
OTTHUMG00000004495 |
| Locus Specific Databases: |
NCL Mutations Mutations of the Palmitoyl-Protein Thioesterase Gene (PPT CLN1) Gene LRG_690 , Neuronal Ceroid Lipofuscinoses |