PPT1 Antibody

Contact us
Catalog number: R32123
Price: 2315 €
Supplier: MBS Recombinant Proteins
Product name: PPT1 Antibody
Quantity: 1000ug
Other quantities: 0.1ml 263€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PPT1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the PPT1 antibody should be determined by the researcher
Intented use: This PPT1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P50897
Purity: Antigen affinity
Description: Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, PPT-1 is a member of the palmitoyl protein thioesterase family, The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues, The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation, Two transcript variants encoding different isoforms have been found for this gene, also known as palmitoyl-protein hydrolase 1, is an enzyme that in humans is encoded by the PPT1 gene, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4), Palmitoyl-protein thioesterase 1 (PPT-1)
Immunogen: Amino acids KEDVYRNHSIFLADINQERGINESYKKNLMALKK of human PPT1 were used as the immunogen for the PPT1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PPT1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PPT1
Short name: PPT1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: palmitoyl-protein thioesterase 1 (Antibody to)
Alternative technique: antibodies
Alternative to gene target: BT, CLN1 and INCL and PPT, PPT1 and IDBG-96867 and ENSG00000131238 and 5538, Ppt1 and IDBG-184539 and ENSMUSG00000028657 and 19063, nuclei, palmitoyl-CoA hydrolase activity, this GO :0002084 and protein depalmitoylation and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005764 and lysosome and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005829 and cytosol and cellular component this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006464 and cellular protein modification process and biological process this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0006907 and pinocytosis and biological process this GO :0007040 and lysosome organization and biological process this GO :0007042 and lysosomal lumen acidification and biological process this GO :0007269 and neurotransmitter secretion and biological process this GO :0007399 and nervous system development and biological process this GO :0007420 and brain development and biological process this GO :0007601 and visual perception and biological process this GO :0007625 and grooming behavior and biological process this GO :0008021 and synaptic vesicle and cellular component this GO :0008306 and associative learning and biological process this GO :0008344 and adult locomotory behavior and biological process this GO :0008474 and palmitoyl-(protein) hydrolase activity and molecular function this GO :0015031 and protein transport and biological process this GO :0016020 and membrane and cellular component this GO :0016042 and lipid catabolic process and biological process this GO :0016290 and palmitoyl-CoA hydrolase activity and molecular function this GO :0030149 and sphin this GO lipid catabolic process and biological process this GO :0030163 and protein catabolic process and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030424 and axon and cellular component this GO :0030425 and dendrite and cellular component this GO :0031579 and membrane raft organization and biological process this GO :0032429 and regulation of phospholipase A2 activity and biological process this GO :0043005 and neuron projection and cellular component this GO :0043025 and neuronal cell body and cellular component this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044257 and cellular protein catabolic process and biological process this GO :0044265 and cellular macromolecule catabolic process and biological process this GO :0045121 and membrane raft and cellular component this GO :0045202 and synapse and cellular component this GO :0048260 and positive regulation of receptor-mediated endocytosis and biological process this GO :0048549 and positive regulation of pinocytosis and biological process this GO :0048666 and neuron development and biological process this GO :0050803 and regulation of synapse structure and activity and biological process this GO :0051181 and cofactor transport and biological process this GO :0051186 and cofactor metabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0008474 : palmitoyl-(protein) hydrolase activity, this GO :0008474 : palmitoyl-(protein) hydrolase activity and also this GO :0016290 : palmitoyl-CoA hydrolase activity, this GO :0016290 : palmitoyl-CoA hydrolase activity, 101768 and IDBG-640822 and ENSBTAG00000013367 and 281421, palmitoyl-protein thioesterase 1
Identity: 9325
Gene: PPT1 | More about : PPT1
Long gene name: palmitoyl-protein thioesterase 1
Synonyms gene: PPT
Synonyms: CLN1 INCL
Synonyms name: ceroid-lipofuscinosis, infantile , neuronal 1
Locus: 1p34, 2
Discovery year: 2000-06-09
GenBank acession: U44772
Entrez gene record: 5538
Pubmed identfication: 7637805 8325646
RefSeq identity: NM_000310
Havana BLAST/BLAT: OTTHUMG00000004495
Locus Specific Databases: NCL Mutations Mutations of the Palmitoyl-Protein Thioesterase Gene (PPT CLN1) Gene LRG_690 , Neuronal Ceroid Lipofuscinoses

Related Products :

GENTAUR-58be3bddca76f Anti- PPT1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be5639d90ed Anti- PPT1 Antibody 50ug 304 € MBS Polyclonals human
GENTAUR-58be563a56789 Anti- PPT1 Antibody 100ug 387 € MBS Polyclonals human
GENTAUR-58be563ab8580 Anti- PPT1 Antibody 0.2 mg 558 € MBS Polyclonals human
abx217916 Anti-PPT1 Antibody 100 μg 311 € abbex human
CPA4493-100ul anti-PPT1 / PPT Antibody 0,1 ml 442 € acr human
CPA4493-200ul anti-PPT1 / PPT Antibody 0,2 ml 688 € acr human
CPA4493-30ul anti-PPT1 / PPT Antibody 30 Вµl 326 € acr human
AP12267PU-N anti-PPT1 / PPT (C-term) Antibody 0,4 ml 587 € acr human
AP12266PU-N anti-PPT1 / PPT (N-term) Antibody 0,4 ml 587 € acr human
bsm-51262M PPT1 (1117CT11.2.1.4) Monoclonal Antibody 0.1ml 211 € Bioss Primary Unconjugated Antibodies human
GWB-MW281B PPT1 antibody 1 vial 521 € genways human
R32123 PPT1 Antibody 0.1mg 406 € NJS poly human
bs-6619R PPT1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
MBS270153 PPT1 antibody [N1C3] 100ul 426 € MBS Polyclonals_1 human
CEL-005538-B01 PPT1 MaxPab Mouse Polyclonal Antibody (B01) 0.05ml 495 € Zyagen mouse
CEL-005538-B01P PPT1 purified MaxPab Mouse Polyclonal Antibody (B01P) 0.05mg 495 € Zyagen mouse
abx904208 Anti-PPT1 siRNA inquire 50 € abbex human
abx929596 Anti-PPT1 siRNA 15 nmol 528 € abbex human
abx929597 Anti-PPT1 siRNA 30 nmol 717 € abbex human
GENTAUR-58bd758f2bd5a Drosophila melanogaster Palmitoyl-protein thioesterase 1 (Ppt1) 100ug 1846 € MBS Recombinant Proteins drosophila
GENTAUR-58bd758f7995e Drosophila melanogaster Palmitoyl-protein thioesterase 1 (Ppt1) 1000ug 1846 € MBS Recombinant Proteins drosophila
GENTAUR-58bd758fb0733 Drosophila melanogaster Palmitoyl-protein thioesterase 1 (Ppt1) 100ug 2354 € MBS Recombinant Proteins drosophila
GENTAUR-58bd75900c1df Drosophila melanogaster Palmitoyl-protein thioesterase 1 (Ppt1) 1000ug 2354 € MBS Recombinant Proteins drosophila
MBS624117 PPT1, CT (Palmitoyl-protein Thioesterase 1, Palmitoyl-protein Hydrolase 1, PPT-1, PPT) 200ul 603 € MBS Polyclonals_1 human
LV270961 PPT1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-EE78B0 PPT1 Over-expression Lysate reagent 1 vial 463 € genways human
CC64 Recombinant Human Palmitoyl-Protein Thioesterase 1, PPT1 (C-6His) 10 µg 146 € novo human
GENTAUR-58bc4c2814cd6 Schizosaccharomyces pombe Serine/threonine-protein phosphatase T (ppt1) 100ug 2315 € MBS Recombinant Proteins human
GENTAUR-58bc4c285e5cb Schizosaccharomyces pombe Serine/threonine-protein phosphatase T (ppt1) 1000ug 2315 € MBS Recombinant Proteins human