| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Palmitoyl-protein thioesterase 1 is produced by our Mammalian expression system and the target gene encoding Asp28-Gly306 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
3 kD, 32 |
| UniProt number: |
P50897 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10%Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, 5, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
DPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAHIIPFLGVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
PPT1 (C-6His), Palmitoyl-Protein Thioesterase 1 |
| Short name: |
PPT1 (C-6His), Recombinant Palmitoyl-Protein Thioesterase 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
palmitoyl-protein thioesterase 1 (C-6His), sapiens Palmitoyl-Protein Thioesterase 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, CLN1 and INCL and PPT, PPT1 and IDBG-96867 and ENSG00000131238 and 5538, Ppt1 and IDBG-184539 and ENSMUSG00000028657 and 19063, nuclei, palmitoyl-CoA hydrolase activity, this GO :0002084 and protein depalmitoylation and biological process this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005764 and lysosome and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005829 and cytosol and cellular component this GO :0006309 and apoptotic DNA fragmentation and biological process this GO :0006464 and cellular protein modification process and biological process this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0006907 and pinocytosis and biological process this GO :0007040 and lysosome organization and biological process this GO :0007042 and lysosomal lumen acidification and biological process this GO :0007269 and neurotransmitter secretion and biological process this GO :0007399 and nervous system development and biological process this GO :0007420 and brain development and biological process this GO :0007601 and visual perception and biological process this GO :0007625 and grooming behavior and biological process this GO :0008021 and synaptic vesicle and cellular component this GO :0008306 and associative learning and biological process this GO :0008344 and adult locomotory behavior and biological process this GO :0008474 and palmitoyl-(protein) hydrolase activity and molecular function this GO :0015031 and protein transport and biological process this GO :0016020 and membrane and cellular component this GO :0016042 and lipid catabolic process and biological process this GO :0016290 and palmitoyl-CoA hydrolase activity and molecular function this GO :0030149 and sphin this GO lipid catabolic process and biological process this GO :0030163 and protein catabolic process and biological process this GO :0030308 and negative regulation of cell growth and biological process this GO :0030424 and axon and cellular component this GO :0030425 and dendrite and cellular component this GO :0031579 and membrane raft organization and biological process this GO :0032429 and regulation of phospholipase A2 activity and biological process this GO :0043005 and neuron projection and cellular component this GO :0043025 and neuronal cell body and cellular component this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043524 and negative regulation of neuron apoptotic process and biological process this GO :0044257 and cellular protein catabolic process and biological process this GO :0044265 and cellular macromolecule catabolic process and biological process this GO :0045121 and membrane raft and cellular component this GO :0045202 and synapse and cellular component this GO :0048260 and positive regulation of receptor-mediated endocytosis and biological process this GO :0048549 and positive regulation of pinocytosis and biological process this GO :0048666 and neuron development and biological process this GO :0050803 and regulation of synapse structure and activity and biological process this GO :0051181 and cofactor transport and biological process this GO :0051186 and cofactor metabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0008474 : palmitoyl-(protein) hydrolase activity, this GO :0008474 : palmitoyl-(protein) hydrolase activity and also this GO :0016290 : palmitoyl-CoA hydrolase activity, this GO :0016290 : palmitoyl-CoA hydrolase activity, 101768 and IDBG-640822 and ENSBTAG00000013367 and 281421, palmitoyl-protein thioesterase 1 |
| Identity: |
9325 |
| Gene: |
PPT1 |
More about : PPT1 |
| Long gene name: |
palmitoyl-protein thioesterase 1 |
| Synonyms gene: |
PPT |
| Synonyms: |
CLN1 INCL |
| Synonyms name: |
ceroid-lipofuscinosis, infantile , neuronal 1 |
| Locus: |
1p34, 2 |
| Discovery year: |
2000-06-09 |
| GenBank acession: |
U44772 |
| Entrez gene record: |
5538 |
| Pubmed identfication: |
7637805 8325646 |
| RefSeq identity: |
NM_000310 |
| Havana BLAST/BLAT: |
OTTHUMG00000004495 |
| Locus Specific Databases: |
NCL Mutations Mutations of the Palmitoyl-Protein Thioesterase Gene (PPT CLN1) Gene LRG_690 , Neuronal Ceroid Lipofuscinoses |