MEK3 Antibody / MAP2K3 / MKK3

Contact us
Catalog number: R32106
Price: 992 €
Supplier: Cellular biology labs
Product name: MEK3 Antibody / MAP2K3 / MKK3
Quantity: 50 μL
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: MEK3 / MAP2K3 / MKK3
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the MKK3 antibody should be determined by the researcher
Intented use: This MKK3 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P46734
Purity: Antigen affinity
Description: (1997) localized the MAP2K3 gene to 17q11, And this kinase can be activated by insulin, Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, It phosphorylates and thus activates MAPK14/p38-MAPK, Rampoldi et al, The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family, This kinase is activated by mitogenic and environmental stress, and confers oncogenic transformation of primary cells, and is necessary for the expression of glucose transporter, and participates in the MAP kinase-mediated signaling cascade, which thus leads to the constitutive activation of MAPK14, 2, Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene
Immunogen: Amino acids AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS of human MAP2K3/MEK3 were used as the immunogen for the MKK3 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MKK3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: MEK3 / MAP2K3 / MKK3
Short name: MEK3 Antibody / MAP2K3 / MKK3
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: MEK3 (Antibody to) / MAP2K3 / MKK3
Alternative technique: antibodies
Identity: 6843
Gene: MAP2K3 | More about : MAP2K3
Long gene name: mitogen-activated protein kinase kinase 3
Synonyms gene: PRKMK3
Synonyms: MEK3 MKK3 MAPKK3
Synonyms name: MAPK/ERK kinase 3 MAP kinase kinase 3 dual specificity mitogen activated protein kinase kinase 3
Locus: 17p11, 2
Discovery year: 1997-11-11
GenBank acession: L36719
Entrez gene record: 5606
Pubmed identfication: 9465908
RefSeq identity: NM_145109
Classification: Mitogen-activated protein kinase kinases
Havana BLAST/BLAT: OTTHUMG00000134322

Related Products :

R32106 MEK3 Antibody / MAP2K3 / MKK3 0.1mg 406 € NJS poly human
GENTAUR-58bde78995f87 Mouse Monoclonal [clone 1D10] (IgG1,k) to Human MAP2K3 / MEK3 / MKK3 Antibody 50ug 663 € MBS mono human
MBS244696 PAb (IgG) to Human MAP2K3 / MEK3 / MKK3 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS616694 MAP Kinase Kinase 3 (Dual Specificity Mitogen-activated Protein Kinase Kinase 3, Mitogen-activated Protein Kinase Kinase 3, MAP2K3, MAPKK 3, MKK3, MAPK/ERK Kinase 3, MEK 3, MEK3, PRKMK3, Stress-activated Protein Kinase Kinase 2, SAPK Kinase 2, SAPKK2, SAP Antibody 200ug 619 € MBS Polyclonals_1 human
bsm-50314M MEK3 (3G2) Monoclonal Antibody 0.1ml 362 € Bioss Primary Unconjugated Antibodies human
GENTAUR-58be3701a1c05 MEK3 antibody 100ul 498 € MBS mono human
R30446 MEK3 Antibody 0.1mg 389 € NJS poly human
R30447 MEK3 Antibody 0.1mg 389 € NJS poly human
YSRTMCA3366Z MEK3, Mouse Monoclonal antibody-; Clone: 2F12 0.1 mg Ask price € accurate-monoclonals mouse
CPA3302-100ul anti-MKK3/6 Antibody 0,1 ml 442 € acr human
CPA3302-200ul anti-MKK3/6 Antibody 0,2 ml 688 € acr human
CPA3302-30ul anti-MKK3/6 Antibody 30 Вµl 326 € acr human
abx134455 Anti-MKK3/6 Antibody 200 μl 398 € abbex human
A03M0145 anti-MKK3 (Ab-189) Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58be3ef28574d Anti- MKK3 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be48296333e Anti- MKK3 Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58be4971e0af6 Anti- MKK3 Antibody 100ug 370 € MBS Polyclonals human
A03M0146 anti-MKK3 (Phospho-Ser189) Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GWB-43DB6E Anti- MKK3 (Phospho-Ser189) Antibody bulk Ask price € genways bulk human
abx133217 Anti-MKK3 (pT222) Antibody 200 ul 427 € abbex human
GWB-ASC756 Human MKK3 (Ab-189) Antibody bulk Ask price € genways bulk human
GWB-ASB740 Human MKK3 (Phospho-Ser189) Antibody bulk Ask price € genways bulk human
MBS619204 MAP Kinase Kinase 3,6, phosphorylated (Ser189/207) (MKK3,6, MAP Kinase Kinase 3, MKK3, MAP Kinase Kinase 6, MKK6) Antibody 100ul 680 € MBS Polyclonals_1 human
MBS619450 MAP Kinase Kinase 3,6, phosphorylated (Ser189/207) (MKK3,6, MAP Kinase Kinase 3, MKK3, MAP Kinase Kinase 6, MKK6) (BSA, Azide & Glycerol Free) Antibody 100ul 796 € MBS Polyclonals_1 human
GWB-FADE8C MKK3 antibody 1 vial 486 € genways human
GWB-3F7B42 MKK3 (Phospho-Ser189) antibody Blocking peptide sequence 1 x 1 vial 255 € genways human
abx162164 Anti-MKK3/6 Blocking Peptide 1 mg 282 € abbex human
abx161926 Anti-MKK3 (pT222) Blocking Peptide 1 mg 325 € abbex human
ADV-122 MKK3 (Constitutively Active) Recombinant Adenovirus 50 μL 992 € Cellular biology labs human
ADV-121 MKK3 (Dominant Negative) Recombinant Adenovirus 50 μL 992 € Cellular biology labs human