| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MEK3 / MAP2K3 / MKK3 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the MKK3 antibody should be determined by the researcher |
| Intented use: |
This MKK3 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P46734 |
| Purity: |
Antigen affinity |
| Description: |
(1997) localized the MAP2K3 gene to 17q11, And this kinase can be activated by insulin, Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, It phosphorylates and thus activates MAPK14/p38-MAPK, Rampoldi et al, The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family, This kinase is activated by mitogenic and environmental stress, and confers oncogenic transformation of primary cells, and is necessary for the expression of glucose transporter, and participates in the MAP kinase-mediated signaling cascade, which thus leads to the constitutive activation of MAPK14, 2, Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene |
| Immunogen: |
Amino acids AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS of human MAP2K3/MEK3 were used as the immunogen for the MKK3 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MKK3 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MEK3 / MAP2K3 / MKK3 |
| Short name: |
MEK3 Antibody / MAP2K3 / MKK3 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
MEK3 (Antibody to) / MAP2K3 / MKK3 |
| Alternative technique: |
antibodies |
| Identity: |
6843 |
| Gene: |
MAP2K3 |
More about : MAP2K3 |
| Long gene name: |
mitogen-activated protein kinase kinase 3 |
| Synonyms gene: |
PRKMK3 |
| Synonyms: |
MEK3 MKK3 MAPKK3 |
| Synonyms name: |
MAPK/ERK kinase 3 MAP kinase kinase 3 dual specificity mitogen activated protein kinase kinase 3 |
| Locus: |
17p11, 2 |
| Discovery year: |
1997-11-11 |
| GenBank acession: |
L36719 |
| Entrez gene record: |
5606 |
| Pubmed identfication: |
9465908 |
| RefSeq identity: |
NM_145109 |
| Classification: |
Mitogen-activated protein kinase kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000134322 |