JNK2 Antibody (alpha/beta)

Contact us
Catalog number: R32105
Price: 591 €
Supplier: genways
Product name: JNK2 Antibody (alpha/beta)
Quantity: 1 x 1 vial
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: JNK2 (alpha/beta)
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the JNK2 antibody should be determined by the researcher
Intented use: This JNK2 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P45984
Purity: Antigen affinity
Description: Also, It is most closely related to MAPK8, MAP kinases act as an integration point for multiple biochemical signals, Several alternatively spliced transcript variants encoding distinct isoforms have been reported, Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation, The protein encoded by this gene is a member of the MAP kinase family, This kinase blocks the ubiquitination of tumor suppressor p53, This kinase targets specific transcription factors, and are involved in a wide variety of cellular processes such as proliferation, and thus it increases the stability of p53 in nonstressed cells, and thus mediates immediate-early gene expression in response to various cell stimuli, both of which are involved in UV radiation induced apoptosis, differentiation, this gene and MAPK8 are also known as c-Jun N-terminal kinases, thought to be related to the cytochrome c-mediated cell death pathway, transcription regulation and development, JNK2 is also known as MAPK9
Immunogen: Amino acids RNYVENRPKYPGIKFEELFPDWIFPSESERDK of human JNK2a/b were used as the immunogen for the JNK2 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the JNK2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: JNK2 (alpha/beta)
Short name: JNK2 Antibody (alpha/beta)
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: JNK2 (Antibody to) (a/b)
Alternative technique: antibodies
Identity: 6886
Gene: MAPK9 | More about : MAPK9
Long gene name: mitogen-activated protein kinase 9
Synonyms gene: PRKM9
Synonyms: JNK2 p54a SAPK
Synonyms name: Jun kinase
Locus: 5q35, 3
Discovery year: 1998-04-28
GenBank acession: U09759
Entrez gene record: 5601
Pubmed identfication: 8001819
Classification: Mitogen-activated protein kinases
Havana BLAST/BLAT: OTTHUMG00000130934

Related Products :

R32105 JNK2 Antibody (alpha/beta) 0.1mg 406 € NJS poly human
MBS616012 SAPKa (SAPK-alpha, SAPK, c-Jun N-terminal Kinase 2, JNK2, Mitogen-activated Protein Kinase 9, MAP Kinase 9, MAPK 9, MAPK9, PRKM9, p54-alpha, Stress-activated Protein Kinase JNK2) Antibody 0.025 ml 376 € MBS Polyclonals_1 human
MBS422699 Goat anti-MAPK9 / JNK2 beta (aa217-230) Antibody 100ug 370 € MBS Polyclonals_1 human
R33884-100UG JNK2 beta Antibody 0.1mg 406 € NJS poly human
MBS422715 Goat anti-MAPK9 / JNK2 alpha (aa217-230) Antibody 100ug 370 € MBS Polyclonals_1 human
R33880-100UG JNK2 alpha Antibody 0.1mg 406 € NJS poly human
GWB-D05DFC C-Jun N-terminusinal Kinase 2 (JNK2/MAPK9) Rabbit antibody to or anti-Human Polyclonal (aa373-389) antibody 1 vial 602 € genways human
GWB-963700 C-Jun N-terminusinal Kinase 2 (JNK2/MAPK9) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
GWB-185EC0 C-Jun N-terminusinal Kinase 2 (JNK2/MAPK9) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 x 1 vial 602 € genways human
abx216712 Anti-JNK2 Antibody inquire 50 € abbex human
AP20729PU-N anti-MAPK8 / JNK1 (+JNK2/3) Antibody 0,1 mg 558 € acr human
AP20730PU-N anti-MAPK8 / JNK1 (+JNK2/3) Antibody 0,1 mg 558 € acr human
AR50473PU-N anti-MAPK9 / JNK2 (1-382, His-tag) Antibody 0,5 mg 1109 € acr human
AR50473PU-S anti-MAPK9 / JNK2 (1-382, His-tag) Antibody 0,1 mg 485 € acr human
AM31822PU-N anti-MAPK9 / JNK2 (1-425) Antibody 50 Вµg 819 € acr human
AP31925PU-N anti-MAPK9 / JNK2 (217-230) Antibody 0,1 mg 558 € acr human
AP31957PU-N anti-MAPK9 / JNK2 (217-230) Antibody 0,1 mg 558 € acr human
AP08457PU-N anti-MAPK9 / JNK2 (373-389) Antibody 50 Вµg 732 € acr human
AP20523PU-N anti-MAPK9 / JNK2 Antibody 0,1 mg 558 € acr human
C12684-1 anti-MAPK9 / JNK2 Antibody 50 Вµg 347 € acr human
C12684-2 anti-MAPK9 / JNK2 Antibody 0,1 mg 500 € acr human
AP08310PU-N anti-MAPK9 / JNK2 (C-term) Antibody 50 Вµg 732 € acr human
AM00079BT-N anti-MAPK9 / JNK2 (incl. pos. control) Antibody 0,1 mg 674 € acr human
AM00079PU-N anti-MAPK9 / JNK2 (incl. pos. control) Antibody 0,1 mg 601 € acr human
AP08311PU-N anti-MAPK9 / JNK2 (N-term) Antibody 50 Вµg 732 € acr human
MBS248159 Goat Polyclonal to Human MAPK9 / JNK2 / SAPK Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-B4735F JNK1 + JNK2 antibody (phospho Thr183/Tyr185) 1 vial 532 € genways human
F50465-0.4ML JNK2 Antibody 0.4 ml 406 € NJS poly human
GENTAUR-58be1f908f675 JNK2 Antibody 100ug 647 € MBS mono human
GWB-49AA7D JNK2 antibody 1 x 1 vial 591 € genways human