| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
JNK2 (alpha/beta) |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the JNK2 antibody should be determined by the researcher |
| Intented use: |
This JNK2 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P45984 |
| Purity: |
Antigen affinity |
| Description: |
Also, It is most closely related to MAPK8, MAP kinases act as an integration point for multiple biochemical signals, Several alternatively spliced transcript variants encoding distinct isoforms have been reported, Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation, The protein encoded by this gene is a member of the MAP kinase family, This kinase blocks the ubiquitination of tumor suppressor p53, This kinase targets specific transcription factors, and are involved in a wide variety of cellular processes such as proliferation, and thus it increases the stability of p53 in nonstressed cells, and thus mediates immediate-early gene expression in response to various cell stimuli, both of which are involved in UV radiation induced apoptosis, differentiation, this gene and MAPK8 are also known as c-Jun N-terminal kinases, thought to be related to the cytochrome c-mediated cell death pathway, transcription regulation and development, JNK2 is also known as MAPK9 |
| Immunogen: |
Amino acids RNYVENRPKYPGIKFEELFPDWIFPSESERDK of human JNK2a/b were used as the immunogen for the JNK2 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the JNK2 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
JNK2 (alpha/beta) |
| Short name: |
JNK2 Antibody (alpha/beta) |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
JNK2 (Antibody to) (a/b) |
| Alternative technique: |
antibodies |
| Identity: |
6886 |
| Gene: |
MAPK9 |
More about : MAPK9 |
| Long gene name: |
mitogen-activated protein kinase 9 |
| Synonyms gene: |
PRKM9 |
| Synonyms: |
JNK2 p54a SAPK |
| Synonyms name: |
Jun kinase |
| Locus: |
5q35, 3 |
| Discovery year: |
1998-04-28 |
| GenBank acession: |
U09759 |
| Entrez gene record: |
5601 |
| Pubmed identfication: |
8001819 |
| Classification: |
Mitogen-activated protein kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000130934 |