| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Leptin / LEP |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Mouse (Mus musculus) |
| Tested applications: |
ELISA, WB |
| Recommended dilutions: |
1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0 |
| Notes: |
Optimal dilution of the Leptin antibody should be determined by the researcher |
| Intented use: |
This Leptin antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P41160 |
| Purity: |
Antigen affinity |
| Description: |
Although regulation of fat stores is deemed to be the primary function of leptin, Many of these additional functions are yet to be defined, Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, The expression of Leptin mRNA has been shown to be restricted to adipose tissue, and rat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors, as evidenced by its multiple sites of synthesis other than fat cells, cDNA clones encoding Leptin have been isolated from human, it also plays a role in other physiological processes, metabolism and body temperature, mouse, simian, Leptin is a protein product of the mouse obese gene |
| Immunogen: |
Amino acids KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH of mouse Leptin were used as the immunogen for the Leptin antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Leptin antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene: |
LEP |
More about : LEP |
| Gene target: |
Leptin / LEP |
| Short name: |
Leptin Antibody / LEP |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Leptin (Antibody to) / leptin |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
Extracellular, LEP and IDBG-39587 and ENSG00000174697 and 3952, LEPD and OB and OBS, Lep and IDBG-130781 and ENSMUSG00000059201 and 16846, OBESE and IDBG-635003 and ENSBTAG00000014911 and 280836, peptide hormone receptor binding, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001542 and ovulation from ovarian follicle and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001819 and positive regulation of cytokine production and biological process this GO :0001890 and placenta development and biological process this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0002021 and response to dietary excess and biological process this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006006 and glucose metabolic process and biological process this GO :0006111 and regulation of gluconeogenesis and biological process this GO :0006112 and energy reserve metabolic process and biological process this GO :0006114 and glycerol biosynthetic process and biological process this GO :0006629 and lipid metabolic process and biological process this GO :0006635 and fatty acid beta-oxidation and biological process this GO :0007165 and signal transduction and biological process this GO :0007260 and tyrosine phosphorylation of STAT protein and biological process this GO :0007565 and female pregnancy and biological process this GO :0007584 and response to nutrient and biological process this GO :0007623 and circadian rhythm and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008203 and cholesterol metabolic process and biological process this GO :0008206 and bile acid metabolic process and biological process this GO :0008217 and regulation of blood pressure and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008343 and adult feeding behavior and biological process this GO :0009062 and fatty acid catabolic process and biological process this GO :0009892 and negative regulation of metabolic process and biological process this GO :0019222 and regulation of metabolic process and biological process this GO :0021954 and central nervous system neuron development and biological process this GO :0030073 and insulin secretion and biological process this GO :0030300 and regulation of intestinal cholesterol absorption and biological process this GO :0032099 and negative regulation of appetite and biological process this GO :0032868 and response to insulin and biological process this GO :0033197 and response to vitamin E and biological process this GO :0033210 and leptin-mediated signaling pathway and biological process this GO :0033686 and positive regulation of luteinizing hormone secretion and biological process this GO :0035630 and bone mineralization involved in bone maturation and biological process this GO :0042307 and positive regulation of protein import into nucleus and biological process this GO :0042445 and hormone metabolic process and biological process this GO :0042517 and positive regulation of tyrosine phosphorylation of Stat3 protein and biological process this GO :0042593 and glucose homeostasis and biological process this GO :0042755 and eating behavior and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043270 and positive regulation of ion transport and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0045087 and innate immune response and biological process this GO :0045598 and regulation of fat cell differentiation and biological process this GO :0045639 and positive regulation of myeloid cell differentiation and biological process this GO :0045906 and negative regulation of vasoconstriction and biological process this GO :0046427 and positive regulation of JAK-STAT cascade and biological process this GO :0046628 and positive regulation of insulin receptor signaling pathway and biological process this GO :0046881 and positive regulation of follicle-stimulating hormone secretion and biological process this GO :0048639 and positive regulation of developmental growth and biological process this GO :0050796 and regulation of insulin secretion and biological process this GO :0050810 and regulation of steroid biosynthetic process and biological process this GO :0050901 and leukocyte tethering or rolling and biological process this GO :0051428 and peptide hormone receptor binding and molecular function this GO :0060587 and regulation of lipoprotein lipid oxidation and biological process this GO :0060612 and adipose tissue development and biological process this GO :0061037 and negative regulation of cartilage development and biological process this GO :0070093 and negative regulation of gluca this GO n secretion and biological process this GO :0071298 and cellular response to L-ascorbic acid and biological process this GO :0071300 and cellular response to retinoic acid and biological process this GO :2000366 and positive regulation of STAT protein import into nucleus and biological process this GO :2000486 and negative regulation of glutamine transport and biological process this GO :2000491 and positive regulation of hepatic stellate cell activation and biological process, this GO :0005179 : hormone activity, this GO :0005179 : hormone activity and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0051428 : peptide hormone receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0051428 : peptide hormone receptor binding, leptin |
| Identity: |
6553 |
| Long gene name: |
leptin |
| Synonyms gene: |
OBS OB |
| Synonyms gene name: |
leptin (murine obesity homolog) leptin (obesity homolog, mouse) |
| Locus: |
7q32, 1 |
| Discovery year: |
1993-01-26 |
| Entrez gene record: |
3952 |
| Pubmed identfication: |
1686014 16932309 |
| Havana BLAST/BLAT: |
OTTHUMG00000157564 |