HNF1B Antibody

Contact us
Catalog number: R32080
Price: 600 €
Supplier: ABM lentivectors
Product name: HNF1B Antibody
Quantity: 1.0 µg DNA
Other quantities: 0.08 ml 199€ 0.1mg 389€ 0.4 ml 406€ 1 tube 486€ 1 vial 411€ 100ug 387€ 200ug 558€ 50ug 304€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: HNF1B
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the HNF1 beta antibody should be determined by the researcher
Intented use: This HNF1 beta antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P35680
Purity: Antigen affinity
Description: HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3, HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis, It is a member of the homeodomain-containing superfamily of transcription factors, Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, TCF1, The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, This gene is mapped to 17q12, Type 5), also known as HNF1B or transcription factor 2 (TCF2), is a human gene, HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B)
Immunogen: Amino acids AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT of human HNF1 beta were used as the immunogen for the HNF1 beta antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HNF1 beta antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: HNF1B
Short name: HNF1B Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: HNF1B (Antibody to)
Alternative technique: antibodies
Identity: 11630
Gene: HNF1B | More about : HNF1B
Long gene name: HNF1 homeobox B
Synonyms gene: TCF2
Synonyms gene name: LF-B3, hepatic, transcription factor 2, variant hepatic nuclear factor
Synonyms: LFB3 VHNF1 HNF1beta MODY5
Locus: 17q12
Discovery year: 1990-05-28
GenBank acession: BC017714
Entrez gene record: 6928
Pubmed identfication: 1677179 10484768
RefSeq identity: NM_000458
Classification: HNF class homeoboxes
Havana BLAST/BLAT: OTTHUMG00000188478

Related Products :

GENTAUR-58bde92e272f3 Anti- HNF1B Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bde92e59054 Anti- HNF1B Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdebb869465 Anti- HNF1B Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdebb8c7207 Anti- HNF1B Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf1ef91038 Anti- HNF1B Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf1efe74cd Anti- HNF1B Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3006f24f0 Anti- HNF1B Antibody 0.2 ml 603 € MBS Polyclonals human
GENTAUR-58be3e5a9418c Anti- HNF1B Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be451eed15e Anti- HNF1B Antibody 100ug 393 € MBS Polyclonals human
F41209-0.08ML HNF1B Antibody 0.08 ml 199 € NJS poly human
F41209-0.4ML HNF1B Antibody 0.4 ml 406 € NJS poly human
GWB-7D3626 HNF1B antibody 1 tube 486 € genways human
GWB-9702DA HNF1B antibody 1 vial 411 € genways human
GWB-ML741C HNF1B antibody 1 vial 521 € genways human
MBS127978 HNF1B Antibody 100ug 387 € MBS Polyclonals_1 human
R31391 HNF1B Antibody 0.1mg 389 € NJS poly human
R32080 HNF1B Antibody 0.1mg 406 € NJS poly human
R35204-100UG HNF1B Antibody 0.1mg 406 € NJS poly human
abx902494 Anti-HNF1B siRNA inquire 50 € abbex human
abx919652 Anti-HNF1B siRNA 30 nmol 717 € abbex human
abx919653 Anti-HNF1B siRNA inquire 50 € abbex human
abx151831 Anti-Human HNF1b ELISA Kit 96 tests 934 € abbex human
abx155641 Anti-Rat HNF1b ELISA Kit 96 tests 992 € abbex rat
AE39779PI-48 ELISA test for Pig Hepatocyte nuclear factor 1-beta (HNF1B) 1x plate of 48 wells 402 € abebio pig
EKU04758 Hepatocyte Nuclear Factor 1 Beta (HNF1b) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU04759 Hepatocyte Nuclear Factor 1 Beta (HNF1b) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human
LV182542 HNF1B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human
LV182543 HNF1B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 600 € ABM lentivectors human
LV182544 HNF1B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV182545 HNF1B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human