| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
HNF1B |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the HNF1 beta antibody should be determined by the researcher |
| Intented use: |
This HNF1 beta antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P35680 |
| Purity: |
Antigen affinity |
| Description: |
HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3, HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis, It is a member of the homeodomain-containing superfamily of transcription factors, Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, TCF1, The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, This gene is mapped to 17q12, Type 5), also known as HNF1B or transcription factor 2 (TCF2), is a human gene, HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B) |
| Immunogen: |
Amino acids AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT of human HNF1 beta were used as the immunogen for the HNF1 beta antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the HNF1 beta antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
HNF1B |
| Short name: |
HNF1B Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
HNF1B (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
11630 |
| Gene: |
HNF1B |
More about : HNF1B |
| Long gene name: |
HNF1 homeobox B |
| Synonyms gene: |
TCF2 |
| Synonyms gene name: |
LF-B3, hepatic, transcription factor 2, variant hepatic nuclear factor |
| Synonyms: |
LFB3 VHNF1 HNF1beta MODY5 |
| Locus: |
17q12 |
| Discovery year: |
1990-05-28 |
| GenBank acession: |
BC017714 |
| Entrez gene record: |
6928 |
| Pubmed identfication: |
1677179 10484768 |
| RefSeq identity: |
NM_000458 |
| Classification: |
HNF class homeoboxes |
| Havana BLAST/BLAT: |
OTTHUMG00000188478 |