ADRA1A Antibody

Contact us
Catalog number: R32076
Price: 600 €
Supplier: ABM lentivectors
Product name: ADRA1A Antibody
Quantity: 1.0 µg DNA
Other quantities: 0.1mg 406€ 0.1ml 263€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ADRA1A
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the ADRA1A antibody should be determined by the researcher
Intented use: This ADRA1A antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P35348
Purity: Antigen affinity
Description: ADRA1A is the predominant ADRA1 subtype in liver and heart, Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, It has been found that ADRA1A transcripts in heart, This gene is mapped to 8p21, also known as alpha-1A adrenergic receptor, and also denotes the human gene encoding it, and it can mediate the contraction of prostate smooth muscle, and prostate, brain, epinephrine and norepinephrine, is an alpha-1 adrenergic receptor, liver, 2, ADRA1A
Immunogen: Amino acids KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD of human ADRA1A were used as the immunogen for the ADRA1A antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ADRA1A antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ADRA1A
Short name: ADRA1A Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: adrenoceptor a 1A (Antibody to)
Alternative technique: antibodies
Alternative to gene target: ADRA1A and IDBG-13362 and ENSG00000120907 and 148, ADRA1A and IDBG-635639 and ENSBTAG00000031632 and 282134, ADRA1C and ADRA1L1 and ALPHA1AAR, Adra1a and IDBG-175481 and ENSMUSG00000045875 and 11549, GABAergic and biological process this GO :0032230 and positive regulation of synaptic transmission, GABAergic and biological process this GO :0035024 and negative regulation of Rho protein signal transduction and biological process this GO :0035265 and organ growth and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042493 and response to drug and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0045760 and positive regulation of action potential and biological process this GO :0045907 and positive regulation of vasoconstriction and biological process this GO :0045987 and positive regulation of smooth muscle contraction and biological process this GO :0046982 and protein heterodimerization activity and molecular function this GO :0055117 and regulation of cardiac muscle contraction and biological process this GO :0060073 and micturition and biological process this GO :0060402 and calcium ion transport into cytosol and biological process this GO :0060452 and positive regulation of cardiac muscle contraction and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071875 and adrenergic receptor signaling pathway and biological process this GO :0090037 and positive regulation of protein kinase C signaling and biological process this GO :0097195 and pilomotor reflex and biological process, nuclei, protein heterodimerization activity, this GO :0001985 and negative regulation of heart rate involved in baroreceptor response to increased systemic arterial blood pressure and biological process this GO :0001994 and norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure and biological process this GO :0001996 and positive regulation of heart rate by epinephrine-norepinephrine and biological process this GO :0001997 and positive regulation of the force of heart contraction by epinephrine-norepinephrine and biological process this GO :0003084 and positive regulation of systemic arterial blood pressure and biological process this GO :0004930 and G-protein coupled receptor activity and molecular function this GO :0004937 and alpha1-adrenergic receptor activity and molecular function this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006939 and smooth muscle contraction and biological process this GO :0007165 and signal transduction and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007200 and phospholipase C-activating G-protein coupled receptor signaling pathway and biological process this GO :0007202 and activation of phospholipase C activity and biological process this GO :0007204 and positive regulation of cytosolic calcium ion concentration and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007512 and adult heart development and biological process this GO :0007568 and aging and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009725 and response to hormone and biological process this GO :0010460 and positive regulation of heart rate and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016049 and cell growth and biological process this GO :0019229 and regulation of vasoconstriction and biological process this GO :0030018 and Z disc and cellular component this GO :0030315 and T-tubule and cellular component this GO :0031965 and nuclear membrane and cellular component this GO :0032229 and negative regulation of synaptic transmission, this GO :0004930 : G-protein coupled receptor activity, this GO :0004930 : G-protein coupled receptor activity and also this GO :0004937 : alpha1-adrenergic receptor activity and also this GO :0046982 : protein heterodimerization activity, this GO :0004937 : alpha1-adrenergic receptor activity, this GO :0046982 : protein heterodimerization activity, adrenoceptor alpha 1A
Identity: 277
Gene: ADRA1A | More about : ADRA1A
Long gene name: adrenoceptor alpha 1A
Synonyms gene: ADRA1C
Synonyms gene name: adrenergic, alpha-1A-, receptor
Synonyms: ADRA1L1
Locus: 8p21, 2
Discovery year: 1991-08-19
GenBank acession: L31774
Entrez gene record: 148
RefSeq identity: NM_033303
Classification: Adrenoceptors
Havana BLAST/BLAT: OTTHUMG00000099459

Related Products :

R32076 ADRA1A Antibody 0.1mg 406 € NJS poly human
R35154-100UG ADRA1A Antibody 0.1mg 406 € NJS poly human
bs-0600R ADRA1A Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
YSRTMCA2912Z ADRA1A, Mouse Monoclonal antibody-; Clone: 4C7, WB, Azide Free 0.1 mg Ask price € accurate-monoclonals mouse
A01A0100 anti-ADRA1A Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
A03A0101 anti-ADRA1A Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdf792325eb Anti- ADRA1A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf79292d35 Anti- ADRA1A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0d977e697 Anti- ADRA1A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0d97da067 Anti- ADRA1A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be3c77ca8b1 Anti- ADRA1A Antibody 100ug 393 € MBS Polyclonals human
abx146584 Anti-ADRA1A Antibody inquire 50 € abbex human
abx146585 Anti-ADRA1A Antibody 100 μg 311 € abbex human
GENTAUR-58be0e43f2579 Anti- ADRA1A-Specific Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0e445c2c8 Anti- ADRA1A-Specific Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdd5a08ea88 Anti- Adrenergic Receptor Alpha 1A (ADRa1A) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdd5a1059f0 Anti- Adrenergic Receptor Alpha 1A (ADRa1A) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdd6b6bc195 Anti- Adrenergic Receptor Alpha 1A (ADRa1A) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bddb7539a79 Anti- Adrenergic Receptor Alpha 1A (ADRa1A) Antibody 100ug 542 € MBS Polyclonals human
SP4061P anti-Alpha-1A adrenergic receptor / ADRA1A (3rd cytopl. dom.) Antibody 50 Вµg 732 € acr human
AP06787PU-N anti-Alpha-1A adrenergic receptor / ADRA1A Antibody 0,1 mg 558 € acr human
AP23087PU-N anti-Alpha-1A adrenergic receptor / ADRA1A Antibody 50 Вµl 732 € acr human
C12028-1 anti-Alpha-1A adrenergic receptor / ADRA1A Antibody 50 Вµg 347 € acr human
C12028-2 anti-Alpha-1A adrenergic receptor / ADRA1A Antibody 0,1 mg 500 € acr human
AP32157PU-N anti-Alpha-1A adrenergic receptor / ADRA1A (C-term) Antibody 0,1 mg 558 € acr human
MBS247573 Anti-Human ADRA1A Antibody 0.05 ml 597 € MBS Polyclonals_1 human
MBS423170 Goat anti-ADRA1A Antibody 100ug 370 € MBS Polyclonals_1 human
GWB-ASD999 Human ADRA1A Antibody bulk Ask price € genways bulk human
GWB-ASF176 Human ADRA1A Antibody bulk Ask price € genways bulk human
LV070171 ADRA1A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human