| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
PCSK6 / PACE4 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the PACE4 antibody should be determined by the researcher |
| Intented use: |
This PACE4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P29122 |
| Purity: |
Antigen affinity |
| Description: |
Alternatively spliced transcript variants encoding different isoforms have been identified, Some of its substrates include transforming growth factor beta related proteins, The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired, This gene encodes a member of the subtilisin-like proprotein convertase family, This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues, This gene is thought to play a role in tumor progression and left-right patterning, and brain, and von Willebrand factor, gut, including neuroendocrine, liver, proalbumin, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway, Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene |
| Immunogen: |
Amino acids RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE of human PCSK6/PACE4 were used as the immunogen for the PACE4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PACE4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
PCSK6 / PACE4 |
| Short name: |
PCSK6 Antibody / PACE4 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
PCSK6 (Antibody to) / PACE4 |
| Alternative technique: |
antibodies |
| Identity: |
8569 |
| Gene: |
PCSK6 |
More about : PCSK6 |
| Long gene name: |
proprotein convertase subtilisin/kexin type 6 |
| Synonyms gene: |
PACE4 |
| Synonyms gene name: |
paired basic amino acid cleaving system 4 |
| Synonyms: |
SPC4 |
| Synonyms name: |
subtilisin-like protease subtilisin-like proprotein convertase 4 subtilisin/kexin-like protease PACE4 |
| Locus: |
15q26 |
| Discovery year: |
1992-06-05 |
| Entrez gene record: |
5046 |
| Pubmed identfication: |
1741956 |
| RefSeq identity: |
NM_002570 |
| Classification: |
Proprotein convertase subtilisin/kexin family |
| Havana BLAST/BLAT: |
OTTHUMG00000172097 |
| Locus Specific Databases: |
LRG_888 |