PCSK6 Antibody / PACE4

Contact us
Catalog number: R32047
Price: 667 €
Supplier: genways
Product name: PCSK6 Antibody / PACE4
Quantity: 1 vial
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: PCSK6 / PACE4
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the PACE4 antibody should be determined by the researcher
Intented use: This PACE4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P29122
Purity: Antigen affinity
Description: Alternatively spliced transcript variants encoding different isoforms have been identified, Some of its substrates include transforming growth factor beta related proteins, The encoded protease is constitutively secreted into the extracellular matrix and expressed in many tissues, The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the trans-Golgi network where a second autocatalytic event takes place and the catalytic activity is acquired, This gene encodes a member of the subtilisin-like proprotein convertase family, This gene encodes one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues, This gene is thought to play a role in tumor progression and left-right patterning, and brain, and von Willebrand factor, gut, including neuroendocrine, liver, proalbumin, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway, Proprotein convertase subtilisin/kexin type 6 is an enzyme that in humans is encoded by the PCSK6 gene
Immunogen: Amino acids RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE of human PCSK6/PACE4 were used as the immunogen for the PACE4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the PACE4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: PCSK6 / PACE4
Short name: PCSK6 Antibody / PACE4
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: PCSK6 (Antibody to) / PACE4
Alternative technique: antibodies
Identity: 8569
Gene: PCSK6 | More about : PCSK6
Long gene name: proprotein convertase subtilisin/kexin type 6
Synonyms gene: PACE4
Synonyms gene name: paired basic amino acid cleaving system 4
Synonyms: SPC4
Synonyms name: subtilisin-like protease subtilisin-like proprotein convertase 4 subtilisin/kexin-like protease PACE4
Locus: 15q26
Discovery year: 1992-06-05
Entrez gene record: 5046
Pubmed identfication: 1741956
RefSeq identity: NM_002570
Classification: Proprotein convertase subtilisin/kexin family
Havana BLAST/BLAT: OTTHUMG00000172097
Locus Specific Databases: LRG_888

Related Products :

GWB-FE5F24 antibody to or anti- Paired Basic Amino Acid Cleaving System 4 (PACE4) (PCSK6) Human antibody 1 vial 1053 € genways human
GWB-777F03 Paired Basic Amino Acid Cleaving System 4 (PACE4) (PCSK6) Rabbit antibody to or anti-Human Polyclonal antibody 1 tube 602 € genways human
AP31111PU-N anti-PCSK6 / PACE4 Antibody 0,1 mg 558 € acr human
AP55205SU-N anti-PCSK6 / PACE4 Antibody 0,2 ml 630 € acr human
AP53222PU-N anti-PCSK6 / PACE4 (C-term) Antibody 0,4 ml 587 € acr human
AP07035PU-N anti-PCSK6 / PACE4 (Internal) Antibody 50 Вµg 732 € acr human
MBS243743 Goat Polyclonal to Human PACE4 / PCSK6 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS243775 Goat Polyclonal to Human PACE4 / PCSK6 Antibody 50ug 597 € MBS Polyclonals_1 human
R32047 PCSK6 Antibody / PACE4 0.1mg 406 € NJS poly human
MBS240128 Anti-Human PACE4 / PCSK6 50ug 597 € MBS Polyclonals_1 human
MBS242327 Anti-Human PACE4 / PCSK6 50ug 597 € MBS Polyclonals_1 human
MBS243430 Anti-Human PACE4 / PCSK6 50ug 597 € MBS Polyclonals_1 human
MBS396016 Paired Basic Amino Acid Cleaving System 4 (PACE4) (PCSK6) 50ug 597 € MBS Polyclonals_1 human
MBS221402 Anti-HUMAN PACE4 Antibody 50ug 818 € MBS Polyclonals_1 human
MBS421755 Goat anti-PACE4 Antibody 100ug 299 € MBS Polyclonals_1 human
GWB-6B403D PACE4 antibody 1 tube 966 € genways human
GENTAUR-58be30ade5280 Anti- PCSK6 Antibody 50ug 724 € MBS Polyclonals human
MBS421630 Goat anti-PCSK6 Antibody 100ug 370 € MBS Polyclonals_1 human
F44208-0.08ML PCSK6 Antibody 0.08 ml 199 € NJS poly human
F44208-0.4ML PCSK6 Antibody 0.4 ml 406 € NJS poly human
GWB-9CA5AA PCSK6 antibody 1 vial 411 € genways human
GWB-MV021C PCSK6 antibody 1 vial 521 € genways human
MBS535600 PCSK6 antibody 50ug 658 € MBS Polyclonals_1 human
R36373-100UG PCSK6 Antibody 0.1mg 406 € NJS poly human
abx928006 Anti-PCSK6 siRNA inquire 50 € abbex human
abx928007 Anti-PCSK6 siRNA 15 nmol 528 € abbex human
GWB-4E3CF6 antibody to or anti- CXC Chemokine Receptor 4 (CXCR4) Rabbit antibody to or anti-Human Polyclonal antibody antibody 1 x 1 vial 602 € genways human
GWB-BFD0EE antibody to or anti- Affinity Purified Chicken antibody to or anti-Pig CRP antibody 1 vial 414 € genways pig
GWB-75D1D0 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN antibody 1 tube 667 € genways human
GWB-B22D54 antibody to or anti-ALPHA-1-antibody to or anti-TRYPSIN (Human Plasma) (Goat) antibody 1 vial 667 € genways human