| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
NME1 / NM23 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the NM23 antibody should be determined by the researcher |
| Intented use: |
This NM23 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P15531 |
| Purity: |
Antigen affinity |
| Description: |
(2003) showed that the Drosophila NME1 homolog, After GZMA loading or cytotoxic T lymphocyte attack, Dammai et al, Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells, GAAD or AWD, Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C, LEF1, NDPKA, NF1, NM23-H1, NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET, SET and NM23H1 translocated to the nucleus and SET was degraded, Sp1, The NME1 gene is mapped on 17q21, The promoters of the mouse and human NME1 genes, Using a Drosophila model system, allowing NM23H1 to nick chromosomal DNA, also called NM23, and response elements to glucocorticoid receptors, awd, contain several binding sites for AP2, is an enzyme that in humans is encoded by the NME1 gene, like those of other NME genes, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway, 33, NME1 |
| Immunogen: |
Amino acids KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR of human NM23A were used as the immunogen for the NM23 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the NM23 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
NME1 / NM23 |
| Short name: |
NME1 Antibody / NM23 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
NME/NM23 nucleoside diphosphate kinase 1 (Antibody to) / NM23 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
AWD and GAAD and NB and NBS and NDKA and NDPK-A and NDPKA and NM23 and NM23-H1, NME1 and IDBG-409263 and ENSG00000239672 and 4830, NME1 and IDBG-638442 and ENSBTAG00000004651 and 404189, Nme1 and IDBG-208565 and ENSMUSG00000037601 and 18102, nuclei, poly(A) RNA binding, this GO :0000287 and magnesium ion binding and molecular function this GO :0004536 and deoxyribonuclease activity and molecular function this GO :0004550 and nucleoside diphosphate kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005525 and GTP binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006165 and nucleoside diphosphate phosphorylation and biological process this GO :0006183 and GTP biosynthetic process and biological process this GO :0006228 and UTP biosynthetic process and biological process this GO :0006241 and CTP biosynthetic process and biological process this GO :0006308 and DNA catabolic process and biological process this GO :0006897 and endocytosis and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0015949 and nucleobase-containing small molecule interconversion and biological process this GO :0016020 and membrane and cellular component this GO :0032587 and ruffle membrane and cellular component this GO :0042802 and identical protein binding and molecular function this GO :0042981 and regulation of apoptotic process and biological process this GO :0043024 and ribosomal small subunit binding and molecular function this GO :0043388 and positive regulation of DNA binding and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0044822 and poly(A) RNA binding and molecular function this GO :0050679 and positive regulation of epithelial cell proliferation and biological process this GO :0055086 and nucleobase-containing small molecule metabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0000287 : magnesium ion binding, this GO :0000287 : magnesium ion binding and also this GO :0004536 : deoxyribonuclease activity and also this GO :0004550 : nucleoside diphosphate kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0005525 : GTP binding and also this GO :0042802 : identical protein binding and also this GO :0043024 : ribosomal small subunit binding and also this GO :0044822 : poly(A) RNA binding, this GO :0004536 : deoxyribonuclease activity, this GO :0004550 : nucleoside diphosphate kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005525 : GTP binding, this GO :0042802 : identical protein binding, this GO :0043024 : ribosomal small subunit binding, this GO :0044822 : poly(A) RNA binding, NME/NM23 nucleoside diphosphate kinase 1 |
| Identity: |
7849 |
| Gene: |
NME1 |
More about : NME1 |
| Long gene name: |
NME/NM23 nucleoside diphosphate kinase 1 |
| Synonyms gene name: |
non-metastatic cells 1, protein (NM23A) expressed in |
| Synonyms: |
NM23 NM23-H1 NDPKA |
| Locus: |
17q21, 33 |
| Discovery year: |
1991-07-26 |
| GenBank acession: |
AL360191 X17620 |
| Entrez gene record: |
4830 |
| Pubmed identfication: |
8270257 19852809 |
| RefSeq identity: |
NM_000269 |
| Classification: |
NME/NM23 family |
| Havana BLAST/BLAT: |
OTTHUMG00000137474 |