| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
3-dioxygenase, IDO1 / Indoleamine 2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the IDO1 antibody should be determined by the researcher |
| Intented use: |
This IDO1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P14902 |
| Purity: |
Antigen affinity |
| Description: |
By fluorescence in situ hybridization, During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, INDO or IDO, This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, at least partly because of the induction of indoleamine 2, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells, most notably IFNG, the assignment is narrowed to chromosome 8p12-p11, yielding an intermediate that deformylates to L-kynurenine, 3-DIOXYGENASE), 3-dioxygenase, IDO1 (INDOLEAMINE 2 |
| Immunogen: |
Amino acids NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH of human IDO1 were used as the immunogen for the IDO1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the IDO1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
3-dioxygenase, IDO1 / Indoleamine 2 |
| Short name: |
3-dioxygenase, IDO1 Antibody / Indoleamine 2 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
3-dioxygenase, 3-dioxygenase 1 (Antibody to) / Indoleamine 2, indoleamine 2 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BT, Cytoplasm, IDO and IDO-1 and INDO, IDO1 and IDBG-18750 and ENSG00000131203 and 3620, Ido1 and IDBG-142448 and ENSMUSG00000031551 and 15930, this GO :0002534 and cytokine production involved in inflammatory response and biological process this GO :0002666 and positive regulation of T cell tolerance induction and biological process this GO :0002678 and positive regulation of chronic inflammatory response and biological process this GO :0002830 and positive regulation of type 2 immune response and biological process this GO :0004833 and tryptophan 2, this GO :0004833 : tryptophan 2, this GO :0004833 : tryptophan 2, this GO :0005515 : protein binding, this GO :0009055 : electron carrier activity, this GO :0020037 : heme binding, this GO :0033754 : indoleamine 2, this GO :0046872 : metal ion binding, tryptophan 2, 19792 and IDBG-629572 and ENSBTAG00000020602 and 506281, 3-dioxygenase 1, 3-dioxygenase activity, 3-dioxygenase activity, 3-dioxygenase activity and also this GO :0005515 : protein binding and also this GO :0009055 : electron carrier activity and also this GO :0020037 : heme binding and also this GO :0033754 : indoleamine 2, 3-dioxygenase activity and also this GO :0046872 : metal ion binding, 3-dioxygenase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006569 and tryptophan catabolic process and biological process this GO :0006954 and inflammatory response and biological process this GO :0007565 and female pregnancy and biological process this GO :0009055 and electron carrier activity and molecular function this GO :0019441 and tryptophan catabolic process to kynurenine and biological process this GO :0020037 and heme binding and molecular function this GO :0030485 and smooth muscle contractile fiber and cellular component this GO :0032421 and stereocilium bundle and cellular component this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032693 and negative regulation of interleukin-10 production and biological process this GO :0032735 and positive regulation of interleukin-12 production and biological process this GO :0033555 and multicellular organismal response to stress and biological process this GO :0033754 and indoleamine 2, 3-dioxygenase activity and molecular function this GO :0034276 and kynurenic acid biosynthetic process and biological process this GO :0034641 and cellular nitrogen compound metabolic process and biological process this GO :0036269 and swimming behavior and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0046007 and negative regulation of activated T cell proliferation and biological process this GO :0046872 and metal ion binding and molecular function this GO :0055114 and oxidation-reduction process and biological process this GO :0070233 and negative regulation of T cell apoptotic process and biological process, indoleamine 2 |
| Identity: |
6059 |
| Gene: |
IDO1 |
More about : IDO1 |
| Long gene name: |
indoleamine 2, 3-dioxygenase 1 |
| Synonyms gene: |
IDO INDO |
| Synonyms gene name: |
indoleamine-pyrrole 2, 3 dioxygenase |
| Locus: |
8p11, 21 |
| Discovery year: |
1993-05-26 |
| GenBank acession: |
M34455 |
| Entrez gene record: |
3620 |
| Pubmed identfication: |
2109605 8404046 |
| RefSeq identity: |
NM_002164 |
| Havana BLAST/BLAT: |
OTTHUMG00000164057 |