| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Osteopontin / OPN / SPP1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
ELISA, WB |
| Recommended dilutions: |
1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0 |
| Notes: |
Optimal dilution of the SPP1 antibody should be determined by the researcher |
| Intented use: |
This SPP1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P10451 |
| Purity: |
Antigen affinity |
| Description: |
Also, And the encoded protein is secreted and binds hydroxyapatite with high affinity, Several transcript variants encoding different isoforms have been found for this gene, The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein, The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix, also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1), this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12, Osteopontin (OPN) |
| Immunogen: |
Amino acids HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN of human Osteopontin/SPP1 were used as the immunogen for the SPP1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SPP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Cytoplasmic |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Osteopontin / OPN / SPP1 |
| Short name: |
Osteopontin Antibody / OPN / SPP1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Osteopontin (Antibody to) / OPN / secreted phosphoprotein 1 |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BNSP and BSPI and ETA-1 and OPN, Extracellular, SPP1 and IDBG-29322 and ENSG00000118785 and 6696, SPP1 and IDBG-641200 and ENSBTAG00000005260 and 281499, Spp1 and IDBG-185485 and ENSMUSG00000029304 and 20750, extracellular matrix binding, this GO :0001503 and ossification and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007155 and cell adhesion and biological process this GO :0007566 and embryo implantation and biological process this GO :0010033 and response to organic substance and biological process this GO :0010811 and positive regulation of cell-substrate adhesion and biological process this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030154 and cell differentiation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0031214 and biomineral tissue development and biological process this GO :0031988 and membrane-bounded vesicle and cellular component this GO :0033280 and response to vitamin D and biological process this GO :0042995 and cell projection and cellular component this GO :0045087 and innate immune response and biological process this GO :0045177 and apical part of cell and cellular component this GO :0045780 and positive regulation of bone resorption and biological process this GO :0046697 and decidualization and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048545 and response to steroid hormone and biological process this GO :0048685 and negative regulation of collateral sprouting of intact axon in response to injury and biological process this GO :0050840 and extracellular matrix binding and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0050840 : extracellular matrix binding, this GO :0005515 : protein binding, this GO :0050840 : extracellular matrix binding, secreted phosphoprotein 1 |
| Identity: |
11255 |
| Gene: |
SPP1 |
More about : SPP1 |
| Long gene name: |
secreted phosphoprotein 1 |
| Synonyms gene: |
BNSP OPN |
| Synonyms gene name: |
osteopontin bone sialoprotein I |
| Synonyms: |
BSPI ETA-1 |
| Synonyms name: |
early T-lymphocyte activation 1 |
| Locus: |
4q22, 1 |
| Discovery year: |
1989-03-06 |
| Entrez gene record: |
6696 |
| Pubmed identfication: |
1575754 |
| Classification: |
Endogenous ligands SIBLING family |
| Havana BLAST/BLAT: |
OTTHUMG00000130599 |