Osteopontin Antibody / OPN / SPP1

Contact us
Catalog number: R31935
Price: 568 €
Supplier: elabsciences
Product name: Osteopontin Antibody / OPN / SPP1
Quantity: 96T
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Osteopontin / OPN / SPP1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: ELISA, WB
Recommended dilutions: 1-0, 1-0, 5ug/ml, 5ug/ml, ELISA : 0, Western blot: 0
Notes: Optimal dilution of the SPP1 antibody should be determined by the researcher
Intented use: This SPP1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P10451
Purity: Antigen affinity
Description: Also, And the encoded protein is secreted and binds hydroxyapatite with high affinity, Several transcript variants encoding different isoforms have been found for this gene, The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein, The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix, also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1), this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12, Osteopontin (OPN)
Immunogen: Amino acids HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN of human Osteopontin/SPP1 were used as the immunogen for the SPP1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SPP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Cytoplasmic
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Osteopontin / OPN / SPP1
Short name: Osteopontin Antibody / OPN / SPP1
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Osteopontin (Antibody to) / OPN / secreted phosphoprotein 1
Alternative technique: antibodies
Alternative to gene target: BNSP and BSPI and ETA-1 and OPN, Extracellular, SPP1 and IDBG-29322 and ENSG00000118785 and 6696, SPP1 and IDBG-641200 and ENSBTAG00000005260 and 281499, Spp1 and IDBG-185485 and ENSMUSG00000029304 and 20750, extracellular matrix binding, this GO :0001503 and ossification and biological process this GO :0001649 and osteoblast differentiation and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007155 and cell adhesion and biological process this GO :0007566 and embryo implantation and biological process this GO :0010033 and response to organic substance and biological process this GO :0010811 and positive regulation of cell-substrate adhesion and biological process this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030154 and cell differentiation and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030593 and neutrophil chemotaxis and biological process this GO :0031214 and biomineral tissue development and biological process this GO :0031988 and membrane-bounded vesicle and cellular component this GO :0033280 and response to vitamin D and biological process this GO :0042995 and cell projection and cellular component this GO :0045087 and innate immune response and biological process this GO :0045177 and apical part of cell and cellular component this GO :0045780 and positive regulation of bone resorption and biological process this GO :0046697 and decidualization and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048545 and response to steroid hormone and biological process this GO :0048685 and negative regulation of collateral sprouting of intact axon in response to injury and biological process this GO :0050840 and extracellular matrix binding and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0050840 : extracellular matrix binding, this GO :0005515 : protein binding, this GO :0050840 : extracellular matrix binding, secreted phosphoprotein 1
Identity: 11255
Gene: SPP1 | More about : SPP1
Long gene name: secreted phosphoprotein 1
Synonyms gene: BNSP OPN
Synonyms gene name: osteopontin bone sialoprotein I
Synonyms: BSPI ETA-1
Synonyms name: early T-lymphocyte activation 1
Locus: 4q22, 1
Discovery year: 1989-03-06
Entrez gene record: 6696
Pubmed identfication: 1575754
Classification: Endogenous ligands SIBLING family
Havana BLAST/BLAT: OTTHUMG00000130599

Related Products :

R31935 Osteopontin Antibody / OPN / SPP1 0.1mg 406 € NJS poly human
C544 Recombinant Human Secreted Phosphoprotein 1, SPP1 , SPP1 (C-6His) 10 µg 100 € novo human
GENTAUR-58b8fab859cfd Schizosaccharomyces pombe Set1 complex component spp1 (spp1) 100ug 2188 € MBS Recombinant Proteins human
GENTAUR-58b8fab909d1d Schizosaccharomyces pombe Set1 complex component spp1 (spp1) 1000ug 2188 € MBS Recombinant Proteins human
GENTAUR-58b8fab96d963 Schizosaccharomyces pombe Set1 complex component spp1 (spp1) 100ug 2702 € MBS Recombinant Proteins human
GENTAUR-58b8fab9c5f09 Schizosaccharomyces pombe Set1 complex component spp1 (spp1) 1000ug 2702 € MBS Recombinant Proteins human
GENTAUR-58b9f9205de89 Schizosaccharomyces pombe Set1 complex component spp1 (spp1) 100ug 2188 € MBS Recombinant Proteins human
GENTAUR-58b9f92106424 Schizosaccharomyces pombe Set1 complex component spp1 (spp1) 1000ug 2188 € MBS Recombinant Proteins human
GENTAUR-58b9f921d66a9 Schizosaccharomyces pombe Set1 complex component spp1 (spp1) 100ug 2702 € MBS Recombinant Proteins human
GENTAUR-58b9f9227e569 Schizosaccharomyces pombe Set1 complex component spp1 (spp1) 1000ug 2702 € MBS Recombinant Proteins human
GENTAUR-58bdc51736a0e Anti- Osteopontin (OPN) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc6b0d10ac Anti- Osteopontin (OPN) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdc6b150210 Anti- Osteopontin (OPN) Antibody 100ug 354 € MBS Polyclonals human
GENTAUR-58bdcd5187bec Anti- Osteopontin (OPN) Antibody 100ug 370 € MBS Polyclonals human
GENTAUR-58bdd10fd4899 Anti- Osteopontin (OPN) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdd11050b2a Anti- Osteopontin (OPN) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdd6957007f Anti- Osteopontin (OPN) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddd3865c93 Anti- Osteopontin (OPN) Antibody 100ug 575 € MBS Polyclonals human
abx571413 Anti-Cow Osteopontin (OPN) ELISA Kit inquire 50 € abbex cow
abx573836 Anti-Dog Osteopontin (OPN) ELISA Kit inquire 50 € abbex dog
abx573243 Anti-Human Osteopontin (OPN) ELISA Kit 96 tests 586 € abbex human
abx575738 Anti-Mouse Osteopontin (OPN) ELISA Kit 96 tests 572 € abbex mouse
abx576066 Anti-Pig Osteopontin (OPN) ELISA Kit inquire 50 € abbex pig
abx570082 Anti-Rabbit Osteopontin (OPN) ELISA Kit inquire 50 € abbex human
abx575190 Anti-Rat Osteopontin (OPN) ELISA Kit inquire 50 € abbex rat
DL-OPN-b Bovine Osteopontin OPN ELISA Kit 96T 962 € DL elisas bovine
AE29588DO Canine Osteopontin (OPN) ELISA Kit 48 wells plate 515 € ab-elisa elisas human
AE29588DO-96 Canine Osteopontin (OPN) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-OPN-c Canine Osteopontin OPN ELISA Kit 96T 921 € DL elisas human
E-EL-Ch0644 Chicken OPN (Osteopontin) ELISA Kit 96T 568 € elabsciences chicken