| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Mineralocorticoid Receptor / MR |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the MR antibody should be determined by the researcher |
| Intented use: |
This MR antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P08235 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in multiple transcript variants, Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy, It belongs to the nuclear receptor family where the ligand diffuses into cells, Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes, This gene encodes the mineralocorticoid receptor, a disorder characterized by urinary salt wasting, also known as MR (mineralocorticoid receptor), group C, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus, is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31, member 2), which mediates aldosterone actions on salt and water balance within restricted target cells, 1-31, 2, NR3C2 (nuclear receptor subfamily 3 |
| Immunogen: |
3 and 4, This sequence is common to isoforms 1, Amino acids HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK of the human protein were used as the immunogen for the MR antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Mineralocorticoid Receptor / MR |
| Short name: |
Mineralocorticoid Receptor Antibody / MR |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Mineralocorticoid Receptor (Antibody to) / MR |
| Alternative technique: |
antibodies |