Mineralocorticoid Receptor Antibody / MR

Contact us
Catalog number: R31912
Price: 536 €
Supplier: MBS Polyclonals_1
Product name: Mineralocorticoid Receptor Antibody / MR
Quantity: 0.05 ml
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: Mineralocorticoid Receptor / MR
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the MR antibody should be determined by the researcher
Intented use: This MR antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: P08235
Purity: Antigen affinity
Description: Alternative splicing results in multiple transcript variants, Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy, It belongs to the nuclear receptor family where the ligand diffuses into cells, Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes, This gene encodes the mineralocorticoid receptor, a disorder characterized by urinary salt wasting, also known as MR (mineralocorticoid receptor), group C, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus, is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31, member 2), which mediates aldosterone actions on salt and water balance within restricted target cells, 1-31, 2, NR3C2 (nuclear receptor subfamily 3
Immunogen: 3 and 4, This sequence is common to isoforms 1, Amino acids HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK of the human protein were used as the immunogen for the MR antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MR antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: Mineralocorticoid Receptor / MR
Short name: Mineralocorticoid Receptor Antibody / MR
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Mineralocorticoid Receptor (Antibody to) / MR
Alternative technique: antibodies

Related Products :

BB-PA1594 anti-Mineralocorticoid receptor Antibody 0,1 mg 471 € acr human
abx128518 Anti-Mineralocorticoid Receptor Antibody 50 μg 383 € abbex human
R30672 Mineralocorticoid Receptor Antibody 0.1mg 389 € NJS poly human
bs-1850R-A350 Mineralocorticoid receptor Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1850R-A488 Mineralocorticoid receptor Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1850R-A555 Mineralocorticoid receptor Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1850R-A594 Mineralocorticoid receptor Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1850R-A647 Mineralocorticoid receptor Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1850R-Biotin Mineralocorticoid receptor Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1850R Mineralocorticoid receptor Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-1850R-Cy3 Mineralocorticoid receptor Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1850R-Cy5 Mineralocorticoid receptor Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1850R-Cy5.5 Mineralocorticoid receptor Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1850R-Cy7 Mineralocorticoid receptor Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1850R-FITC Mineralocorticoid receptor Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1850R-HRP Mineralocorticoid receptor Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
R31912 Mineralocorticoid Receptor Antibody / MR 0.1mg 406 € NJS poly human
abx572782 Anti-Human Mineralocorticoid Receptor (MR) ELISA Kit 96 tests 731 € abbex human
GENTAUR-58be5fdfb25f6 Anti-Mineralocorticoid receptor, ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx167147 Anti-Mineralocorticoid Receptor Protein (Recombinant) 100 μg 905 € abbex human
abx256217 Anti-Rat Mineralocorticoid receptor ELISA Kit inquire 50 € abbex rat
abx571079 Anti-Rat Mineralocorticoid Receptor (MR) ELISA Kit inquire 50 € abbex rat
DL-MR-Hu Human Mineralocorticoid Receptor MR ELISA Kit 96T 846 € DL elisas human
EKU05966 Mineralocorticoid Receptor (MR) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU05967 Mineralocorticoid Receptor (MR) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
DL-MR-Ra Rat Mineralocorticoid Receptor MR ELISA Kit 96T 904 € DL elisas rat
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
MBS622505 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Ox-1-R, Ox1-R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS622255 Tachykinin Receptor 1 (TACR1, TAC1R, Neurokinin 1 Receptor, NK1 Receptor, NK-1 Receptor, NK-1R, NK1R, NKIR, Substance P Receptor, SPR) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS615516 APJ Receptor (APLNR, Apelin receptor, AGTRL1, angiotensin II receptor-like 1, Angiotensin receptor-like 1, Apelin receptor, APJ, APJR, FLJ90771, G-protein coupled receptor APJ, HG11, MGC45246) Antibody 0.05 ml 536 € MBS Polyclonals_1 human