| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Specificity Protein 1 / SP1 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
1-0, 5ug/ml, Western blot: 0 |
| Notes: |
Optimal dilution of the SP1 antibody should be determined by the researcher |
| Intented use: |
This SP1 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
P08047 |
| Purity: |
Antigen affinity |
| Description: |
(1993) concluded that 12q13, (1993) showed that one of these genes is the Drosophila homolog of the human transcription factor SP1, By fluorescence in situ hybridization, By in situ hybridization, Gaynor et al, It belongs to the Sp/KLF family of transcription factors, Matera and Ward (1993) mapped the SP1 gene to 12q13, Segmentation in Drosophila is based on a cascade of hierarchical gene interactions initiated by maternally deposited morphogens that define the spatially restricted domains of gap gene expression at blastoderm, The formation of 7 head segments depends on the function of several genes, The protein is 785 amino acids long, Wimmer et al, also known as Specificity Protein 1, is a human transcription factor involved in gene expression in the early development of an organism, with a molecular weight of 81 kDA, 1 is the most probable location of the SP1 gene, SP1 (transcription factor Sp1) |
| Immunogen: |
Amino acids EAICPEGIARLANSGINVMQVADLQSINISGNGF of human SP1 were used as the immunogen for the SP1 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SP1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Protein 1 / SP1 |
| Short name: |
Protein 1 Antibody / SP1 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Specificity Protein 1 (Antibody to) / SP1 |
| Alternative technique: |
antibodies |
| Identity: |
11205 |
| Gene: |
SP1 |
More about : SP1 |
| Long gene name: |
Sp1 transcription factor |
| Synonyms name: |
specificity protein 1 |
| Locus: |
12q13, 13 |
| Discovery year: |
1991-06-04 |
| GenBank acession: |
J03133 |
| Entrez gene record: |
6667 |
| Pubmed identfication: |
1662663 |
| Classification: |
Sp transcription factors Zinc fingers C2H2-type |
| Havana BLAST/BLAT: |
OTTHUMG00000170047 |