ABCA1 Antibody

Contact us
Catalog number: R31847
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: ABCA1 Antibody
Quantity: 100ul
Other quantities: 0.1mg 389€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: ABCA1
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the ABCA1 antibody should be determined by the researcher
Intented use: This ABCA1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O95477
Purity: Antigen affinity
Description: ABC proteins transport various molecules across extra- and intracellular membranes contain 2, Addition of potential lipid substrates or lipid acceptors did not modify the ATPase activity or nucleotide occlusion by ABCA1, Dot blot analysis of 50 tissues revealed ubiquitous expression of ABCA1 mRNA, Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes, Mg(2+)-dependent ATP binding and low basal ATPase activity, Szakacs et al, Szakacs et al, The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters, This protein is a member of the ABCA subfamily, Using human ABCA1 expressed in the membrane fraction of sf9 insect cells, With cholesterol as its substrate, adrenal glands, also known as ABC1, and all fetal tissues examined, and bone marrow, and lowest expression in kidney, found specific, liver, lung, mammary gland, member 1), pancreas, pituitary, speculated that ABCA1 may be a regulatory protein or may require other protein partners for full activation, sub-family A (ABC1), the cholesterol efflux regulatory protein (CERP) is a protein which in humans is encoded by the ABCA1 gene, this protein functions as a cholesterolefflux pump in the cellular lipid removal pathway, with highest expression in placenta, 261 amino acids, ABCA1 (ATP-binding cassette
Immunogen: Amino acids KDLSLHKNQTVVDVAVLTSFLQDEKVKESYV of human ABCA1 were used as the immunogen for the ABCA1 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the ABCA1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: ABCA1
Short name: ABCA1 Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: member 1 (Antibody to), sub-family A (ABC1), adenosine triphosphate-binding cassette
Alternative technique: antibodies
Alternative to gene target: ABC-1 and ABC1 and CERP and HDLDT1 and TGD, ABCA1 and IDBG-79441 and ENSG00000165029 and 19, ATPase binding, Abca1 and IDBG-147642 and ENSMUSG00000015243 and 11303, BT, Cell surfaces, engulfment and biological process this GO :0007040 and lysosome organization and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0007584 and response to nutrient and biological process this GO :0008203 and cholesterol metabolic process and biological process this GO :0008509 and anion transmembrane transporter activity and molecular function this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010745 and negative regulation of macrophage derived foam cell differentiation and biological process this GO :0010875 and positive regulation of cholesterol efflux and biological process this GO :0010887 and negative regulation of cholesterol storage and biological process this GO :0015485 and cholesterol binding and molecular function this GO :0015914 and phospholipid transport and biological process this GO :0016197 and endosomal transport and biological process this GO :0016887 and ATPase activity and molecular function this GO :0017127 and cholesterol transporter activity and molecular function this GO :0019905 and syntaxin binding and molecular function this GO :0030139 and endocytic vesicle and cellular component this GO :0030301 and cholesterol transport and biological process this GO :0030819 and positive regulation of cAMP biosynthetic process and biological process this GO :0031267 and small GTPase binding and molecular function this GO :0032367 and intracellular cholesterol transport and biological process this GO :0032489 and regulation of Cdc42 protein signal transduction and biological process this GO :0033344 and cholesterol efflux and biological process this GO :0033700 and phospholipid efflux and biological process this GO :0034185 and apolipoprotein binding and molecular function this GO :0034186 and apolipoprotein A-I binding and molecular function this GO :0034188 and apolipoprotein A-I receptor activity and molecular function this GO :0034364 and high-density lipoprotein particle and cellular component this GO :0034380 and high-density lipoprotein particle assembly and biological process this GO :0034616 and response to laminar fluid shear stress and biological process this GO :0038027 and apolipoprotein A-I-mediated signaling pathway and biological process this GO :0042157 and lipoprotein metabolic process and biological process this GO :0042158 and lipoprotein biosynthetic process and biological process this GO :0042493 and response to drug and biological process this GO :0042632 and cholesterol homeostasis and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043691 and reverse cholesterol transport and biological process this GO :0044255 and cellular lipid metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045332 and phospholipid translocation and biological process this GO :0045335 and pha this GO cytic vesicle and cellular component this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050702 and interleukin-1 beta secretion and biological process this GO :0051117 and ATPase binding and molecular function this GO :0055091 and phospholipid homeostasis and biological process this GO :0055098 and response to low-density lipoprotein particle stimulus and biological process this GO :0060155 and platelet dense granule organization and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071300 and cellular response to retinoic acid and biological process this GO :0071397 and cellular response to cholesterol and biological process, member 1, sub-family A (ABC1), this GO :0002790 and peptide secretion and biological process this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005543 and phospholipid binding and molecular function this GO :0005548 and phospholipid transporter activity and molecular function this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006200 and ATP catabolic process and biological process this GO :0006497 and protein lipidation and biological process this GO :0006911 and pha this GO cytosis, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0005543 : phospholipid binding and also this GO :0005548 : phospholipid transporter activity and also this GO :0008509 : anion transmembrane transporter activity and also this GO :0015485 : cholesterol binding and also this GO :0016887 : ATPase activity and also this GO :0017127 : cholesterol transporter activity and also this GO :0019905 : syntaxin binding and also this GO :0031267 : small GTPase binding and also this GO :0034185 : apolipoprotein binding and also this GO :0034186 : apolipoprotein A-I binding and also this GO :0034188 : apolipoprotein A-I receptor activity and also this GO :0051117 : ATPase binding, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0005543 : phospholipid binding, this GO :0005548 : phospholipid transporter activity, this GO :0008509 : anion transmembrane transporter activity, this GO :0015485 : cholesterol binding, this GO :0016887 : ATPase activity, this GO :0017127 : cholesterol transporter activity, this GO :0019905 : syntaxin binding, this GO :0031267 : small GTPase binding, this GO :0034185 : apolipoprotein binding, this GO :0034186 : apolipoprotein A-I binding, this GO :0034188 : apolipoprotein A-I receptor activity, this GO :0051117 : ATPase binding, 89249 and IDBG-637291 and ENSBTAG00000020661 and 535379, ATP-binding cassette
Identity: 29
Gene: ABCA1 | More about : ABCA1
Long gene name: ATP binding cassette subfamily A member 1
Synonyms gene: ABC1 HDLDT1
Synonyms gene name: ATP-binding cassette, member 1 , sub-family A (ABC1)
Synonyms: TGD
Synonyms name: Tangier disease
Locus: 9q31, 1
Discovery year: 2005-03-17
GenBank acession: AJ012376
Entrez gene record: 19
Pubmed identfication: 8088782 10431236 10431237 10431238
RefSeq identity: NM_005502
Classification: ATP binding cassette subfamily A
Havana BLAST/BLAT: OTTHUMG00000020417

Related Products :

GWB-6660F1 ATP-Binding Cassette Sub-Family A (Abc1) Member 1 (ABCA1) Mouse antibody to or anti-Human Monoclonal (aa1800-2260) antibody 1 tube 602 € genways human
bs-1627R-A350 ABCA1/ABC1 Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1627R-A488 ABCA1/ABC1 Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1627R-A555 ABCA1/ABC1 Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1627R-A594 ABCA1/ABC1 Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1627R-A647 ABCA1/ABC1 Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-1627R-Biotin ABCA1/ABC1 Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1627R ABCA1/ABC1 Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-1627R-Cy3 ABCA1/ABC1 Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1627R-Cy5 ABCA1/ABC1 Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1627R-Cy5.5 ABCA1/ABC1 Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1627R-Cy7 ABCA1/ABC1 Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1627R-FITC ABCA1/ABC1 Antibody, FITC Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-1627R-HRP ABCA1/ABC1 Antibody, HRP Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-1627R-PE ABCA1/ABC1 Antibody, PE Conjugated 0.1ml 368 € Bioss Primary Conjugated Antibodies human
GWB-B7B436 ABCA1, antibody 1 vial 532 € genways human
GWB-MP560B Abca1 antibody 1 vial 521 € genways human
R30941 ABCA1 Antibody 0.1mg 389 € NJS poly human
R31847 ABCA1 Antibody 0.1mg 406 € NJS poly human
GENTAUR-58be2c5e249d0 ABCA1 (clone: HJ1), Monoclonal Antibody, Mouse 100ul 409 € MBS mono mouse
YSRTMCA2878 ABCA1, Rat Mouse Monoclonal antibody-Mouse; Clone: 3A1-891.3, flow 0.25 mg 304 € accurate-monoclonals mouse
YSRTMCA2878F ABCA1, Rat Mouse Monoclonal antibody-Mouse; Clone: 3A1-891.3, flow, FITC conj. 0.1 mg 248 € accurate-monoclonals mouse
YSRTMCA2681A488 ABCA1, Rat Mouse Monoclonal antibody-Mouse; Clone: 5A1-1422, flow, Alexa Fluor 488 conj. 100 tests/ 1000ul Ask price € accurate-monoclonals mouse
YSRTMCA2681A647 ABCA1, Rat Mouse Monoclonal antibody-Mouse; Clone: 5A1-1422, flow, Alexa Fluor 647 conj. 100 tests/ 1000ul Ask price € accurate-monoclonals mouse
YSRTMCA2681F ABCA1, Rat Mouse Monoclonal antibody-Mouse; Clone: 5A1-1422, flow, FITC conj. 0.1 mg 250 € accurate-monoclonals mouse
YSRTMCA2681 ABCA1, Rat Mouse Monoclonal antibody-Mouse; Clone: 5A1-1422, flow,IF,WB 0.25 mg 333 € accurate-monoclonals mouse
bs-12956R-A350 ABCA1 (Ser2054) Antibody, ALEXA FLUOR 350 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-12956R-A488 ABCA1 (Ser2054) Antibody, ALEXA FLUOR 488 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-12956R-A555 ABCA1 (Ser2054) Antibody, ALEXA FLUOR 555 100ul 350 € Bioss Primary Conjugated Antibodies. human
bs-12956R-A594 ABCA1 (Ser2054) Antibody, ALEXA FLUOR 594 100ul 350 € Bioss Primary Conjugated Antibodies. human