UNC5C Antibody

Contact us
Catalog number: R31843
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: UNC5C Antibody
Quantity: 0.1ml
Other quantities: 0.1mg 406€ 1 vial 521€
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: UNC5C
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: WB
Recommended dilutions: 1-0, 5ug/ml, Western blot: 0
Notes: Optimal dilution of the UNC5C antibody should be determined by the researcher
Intented use: This UNC5C antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O95185
Purity: Antigen affinity
Description: Netrins are secreted proteins that direct axon extension and cell migration during neural development, The UNC-5 family of receptors mediates the repellent response to netrin, They are bifunctional proteins that act as attractants for some cell types and as repellents for others, This gene product belongs to the UNC-5 family of netrin receptors, and these opposite actions are thought to be mediated by two classes of receptors, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region, Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene
Immunogen: Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the UNC5C antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: UNC5C
Short name: UNC5C Antibody
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: elegans) (Antibody to), unc-5 homolog C (C
Alternative technique: antibodies
Alternative to gene target: Plasma membranes, UNC5C and IDBG-30714 and ENSG00000182168 and 8633, UNC5C and IDBG-640984 and ENSBTAG00000002084 and 533256, UNC5H3, Unc5c and IDBG-196891 and ENSMUSG00000059921 and 22253, elegans), protein binding, this GO :0005042 and netrin receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007165 and signal transduction and biological process this GO :0007411 and axon guidance and biological process this GO :0007420 and brain development and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0030334 and regulation of cell migration and biological process this GO :0033564 and anterior/posterior axon guidance and biological process this GO :0038007 and netrin-activated signaling pathway and biological process this GO :0043065 and positive regulation of apoptotic process and biological process, this GO :0005042 : netrin receptor activity, this GO :0005042 : netrin receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, unc-5 homolog C (C
Identity: 12569
Gene: UNC5C | More about : UNC5C
Long gene name: unc-5 netrin receptor C
Synonyms gene name: elegans) , unc5 (C, elegans homolog) c unc-5 homolog C (C
Locus: 4q22, 3
Discovery year: 1998-12-09
GenBank acession: AF055634
Entrez gene record: 8633
Pubmed identfication: 9126742 9782087 12655055
RefSeq identity: NM_003728
Classification: I-set domain containing
Havana BLAST/BLAT: OTTHUMG00000130989

Related Products :

MBS621484 UNC5C (Unc-5 Homolog C, Netrin Receptor UNC5C Precursor, UNC5H3, Unc-5 Homolog 3, Unc-5 Homolog C) Antibody 100ug 591 € MBS Polyclonals_1 human
GENTAUR-58b8b8ec4ff55 Human Netrin receptor UNC5C (UNC5C) 100ug 1973 € MBS Recombinant Proteins human
GENTAUR-58b8b8ecb7c0a Human Netrin receptor UNC5C (UNC5C) 1000ug 1973 € MBS Recombinant Proteins human
GENTAUR-58b8b8ed20308 Human Netrin receptor UNC5C (UNC5C) 100ug 2487 € MBS Recombinant Proteins human
GENTAUR-58b8b8ed5b13b Human Netrin receptor UNC5C (UNC5C) 1000ug 2487 € MBS Recombinant Proteins human
GENTAUR-58b9b8ce12aa4 Human Netrin receptor UNC5C (UNC5C) 100ug 1973 € MBS Recombinant Proteins human
GENTAUR-58b9b8ce7af93 Human Netrin receptor UNC5C (UNC5C) 1000ug 1973 € MBS Recombinant Proteins human
GENTAUR-58b9b8ced67f7 Human Netrin receptor UNC5C (UNC5C) 100ug 2487 € MBS Recombinant Proteins human
GENTAUR-58b9b8cf3f27b Human Netrin receptor UNC5C (UNC5C) 1000ug 2487 € MBS Recombinant Proteins human
GENTAUR-58bb8354ce2b1 Mouse Netrin receptor UNC5C (Unc5c) 100ug 1973 € MBS Recombinant Proteins mouse
GENTAUR-58bb83552ee8a Mouse Netrin receptor UNC5C (Unc5c) 1000ug 1973 € MBS Recombinant Proteins mouse
GENTAUR-58bb835576081 Mouse Netrin receptor UNC5C (Unc5c) 100ug 2487 € MBS Recombinant Proteins mouse
GENTAUR-58bb8355af474 Mouse Netrin receptor UNC5C (Unc5c) 1000ug 2487 € MBS Recombinant Proteins mouse
GENTAUR-58be40c4e99ca Anti- UNC5C Antibody 100ug 393 € MBS Polyclonals human
abx216003 Anti-UNC5C Antibody inquire 50 € abbex human
AP17822PU-N anti-UNC5C (Center) Antibody 0,4 ml 587 € acr human
MBS421760 Goat anti-UNC5C Antibody 100ug 370 € MBS Polyclonals_1 human
MBS244222 Goat Polyclonal to Human UNC5H3 / UNC5C Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-MQ130D UNC5C antibody 1 vial 521 € genways human
GWB-MQ131E UNC5C antibody 1 vial 521 € genways human
R31843 UNC5C Antibody 0.1mg 406 € NJS poly human
R34772-100UG UNC5C Antibody 0.1mg 406 € NJS poly human
bs-11493R-A350 UNC5H3/UNC5C Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11493R-A488 UNC5H3/UNC5C Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11493R-A555 UNC5H3/UNC5C Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11493R-A594 UNC5H3/UNC5C Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11493R-A647 UNC5H3/UNC5C Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-11493R-Biotin UNC5H3/UNC5C Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-11493R UNC5H3/UNC5C Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-11493R-Cy3 UNC5H3/UNC5C Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human