p95 NBS1 Antibody

Catalog number:	R31829 Buy Now
Price:	255 €
Supplier:	genways
Product name:	p95 NBS1 Antibody
Quantity:	1 vial
Other quantities:	0.1ml 263€ 50ug 470€
Related search:	nbs antibody gene antibodies atv thawing

More details Need more?:

Category:	Antibody
Concentration:	2ml sterile DI water, 5mg/ml if reconstituted with 0
Form:	Antigen affinity purified
Conjugation:	Unconjugated
Clone:	Polyclonal antibody
Recognised antigen:	p95 NBS1
Host animal:	Rabbit (Oryctolagus cuniculus)
Clonality:	Polyclonal (rabbit origin)
Species reactivity:	Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications:	IHC-P, WB
Recommended dilutions:	1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes:	Optimal dilution of the p95 NBS1 antibody should be determined by the researcher
Intented use:	This p95 NBS1 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #:	O60934
Purity:	Antigen affinity
Description:	It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand breaks (DSBs), It is a 754 amino acid protein identified as a member of the NBS1/hMre11/RAD50 (N/M/R or MRN) double strand DNA break repair complex, Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome, This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci, also known as NBN or Nibrin, is a protein which in humans is encoded by the NBN gene, p95 NBS1
Immunogen:	Amino acids RKNTELEEWLRQEMEVQNQHAKEESLADDLFR of human p95 NBS1 were used as the immunogen for the p95 NBS1 antibody
Storage:	Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the p95 NBS1 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization:	Nuclear
Properties:	C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target:	p95 NBS1
Short name:	p95 NBS1 Antibody
Technique:	antibodies against human proteins, antibodies for, Antibody
Alternative name:	p95 NBS1 (Antibody to)
Alternative technique:	antibodies
Identity:	7652
Gene:	NBN | More about : NBN
Long gene name:	nibrin
Synonyms gene:	NBS NBS1
Synonyms gene name:	Nijmegen breakage syndrome 1 (nibrin)
Synonyms:	ATV AT-V2 AT-V1
Locus:	8q21, 3
Discovery year:	1997-11-28
GenBank acession:	AF058696
Entrez gene record:	4683
Pubmed identfication:	9590181 9590180
RefSeq identity:	NM_001024688
Classification:	BRCA1 C complex MRN complex
Havana BLAST/BLAT:	OTTHUMG00000153546
Locus Specific Databases:	LOVD - Leiden Open Variation Database LRG_158

• #nbs
• #antibody
• #gene
• #antibodies
• #atv
• #thawing