SLUG Antibody / SNAI2

Contact us
Catalog number: R31818
Price: 1790 €
Supplier: MBS Recombinant Proteins
Product name: SLUG Antibody / SNAI2
Quantity: 1000ug
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SLUG / SNAI2
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the SLUG antibody should be determined by the researcher
Intented use: This SLUG antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O43623
Purity: Antigen affinity
Description: Mutations in this gene may be associated with sporatic cases of neural tube defects, The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma, This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors, This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity, SLUG is also known as SNAI2
Immunogen: Amino acids KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ of human SLUG were used as the immunogen for the SLUG antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SLUG antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SLUG / SNAI2
Short name: SLUG Antibody / SNAI2
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: SLUG (Antibody to) / SNAI2
Alternative technique: antibodies
Identity: 11094
Gene: SNAI2 | More about : SNAI2
Long gene name: snail family transcriptional repressor 2
Synonyms gene: SLUG
Synonyms gene name: slug homolog, zinc finger protein (chicken) snail homolog 2 (Drosophila) snail family zinc finger 2
Synonyms: SLUGH1 SNAIL2 SLUGH
Locus: 8q11, 21
Discovery year: 1998-07-03
GenBank acession: U97060
Entrez gene record: 6591
Pubmed identfication: 9337409 9721220
RefSeq identity: NM_003068
Classification: Zinc fingers C2H2-type SNAG transcriptional repressors
Havana BLAST/BLAT: OTTHUMG00000149912

Related Products :

MBS240368 Anti-Human SNAI2 / SLUG Antibody 50ug 597 € MBS Polyclonals_1 human
MBS241318 Anti-Human SNAI2 / SLUG Antibody 50ug 597 € MBS Polyclonals_1 human
AR51898PU-N anti-SNAI2 / SLUG (1-268, His-tag) Antibody 0,5 mg 1109 € acr human
AR51898PU-S anti-SNAI2 / SLUG (1-268, His-tag) Antibody 0,1 mg 485 € acr human
AM06436SU-N anti-SNAI2 / SLUG Antibody 0,1 ml 630 € acr human
AP05600PU-N anti-SNAI2 / SLUG Antibody 0,1 mg 514 € acr human
AP07353PU-N anti-SNAI2 / SLUG Antibody 50 Вµg 732 € acr human
AP07738PU-N anti-SNAI2 / SLUG Antibody 50 Вµg 732 € acr human
CPA3014-100ul anti-SNAI2 / SLUG Antibody 0,1 ml 442 € acr human
CPA3014-200ul anti-SNAI2 / SLUG Antibody 0,2 ml 688 € acr human
CPA3014-30ul anti-SNAI2 / SLUG Antibody 30 Вµl 326 € acr human
AP11930PU-N anti-SNAI2 / SLUG (Center) Antibody 0,4 ml 587 € acr human
AP30812CP-N anti-SNAI2 / SLUG Control Peptide Antibody 50 Вµg 282 € acr human
AP30813CP-N anti-SNAI2 / SLUG Control Peptide Antibody 50 Вµg 282 € acr human
AP11931PU-N anti-SNAI2 / SLUG (N-term) Antibody 0,4 ml 587 € acr human
F47911-0.08ML SLUG Antibody (SNAI2) 0.08 ml 199 € NJS poly human
F47911-0.4ML SLUG Antibody (SNAI2) 0.4 ml 406 € NJS poly human
F47912-0.08ML SLUG Antibody (SNAI2) 0.08 ml 199 € NJS poly human
R31818 SLUG Antibody / SNAI2 0.1mg 406 € NJS poly human
MBS242652 Anti-Human SNAI2 / SLUG 200ul 597 € MBS Polyclonals_1 human
GENTAUR-58b81bfb17945 Human Zinc finger protein SNAI2 (SNAI2) 100ug 1790 € MBS Recombinant Proteins human
GENTAUR-58b81bfb727d3 Human Zinc finger protein SNAI2 (SNAI2) 1000ug 1790 € MBS Recombinant Proteins human
GENTAUR-58b81bfbe0ec3 Human Zinc finger protein SNAI2 (SNAI2) 100ug 2304 € MBS Recombinant Proteins human
GENTAUR-58b81bfc3d5e1 Human Zinc finger protein SNAI2 (SNAI2) 1000ug 2304 € MBS Recombinant Proteins human
GENTAUR-58b845936c80a Human Zinc finger protein SNAI2 (SNAI2) 100ug 1790 € MBS Recombinant Proteins human
GENTAUR-58b84593d47b6 Human Zinc finger protein SNAI2 (SNAI2) 1000ug 1790 € MBS Recombinant Proteins human
GENTAUR-58b8459448a7a Human Zinc finger protein SNAI2 (SNAI2) 100ug 2304 € MBS Recombinant Proteins human
GENTAUR-58b845949be07 Human Zinc finger protein SNAI2 (SNAI2) 1000ug 2304 € MBS Recombinant Proteins human
GENTAUR-58b8e75e9a4b8 Rat Zinc finger protein SNAI2 (Snai2) 100ug 1790 € MBS Recombinant Proteins rat
GENTAUR-58b8e75f12ce8 Rat Zinc finger protein SNAI2 (Snai2) 1000ug 1790 € MBS Recombinant Proteins rat