| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SLUG / SNAI2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the SLUG antibody should be determined by the researcher |
| Intented use: |
This SLUG antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O43623 |
| Purity: |
Antigen affinity |
| Description: |
Mutations in this gene may be associated with sporatic cases of neural tube defects, The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma, This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors, This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity, SLUG is also known as SNAI2 |
| Immunogen: |
Amino acids KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ of human SLUG were used as the immunogen for the SLUG antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the SLUG antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SLUG / SNAI2 |
| Short name: |
SLUG Antibody / SNAI2 |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SLUG (Antibody to) / SNAI2 |
| Alternative technique: |
antibodies |
| Identity: |
11094 |
| Gene: |
SNAI2 |
More about : SNAI2 |
| Long gene name: |
snail family transcriptional repressor 2 |
| Synonyms gene: |
SLUG |
| Synonyms gene name: |
slug homolog, zinc finger protein (chicken) snail homolog 2 (Drosophila) snail family zinc finger 2 |
| Synonyms: |
SLUGH1 SNAIL2 SLUGH |
| Locus: |
8q11, 21 |
| Discovery year: |
1998-07-03 |
| GenBank acession: |
U97060 |
| Entrez gene record: |
6591 |
| Pubmed identfication: |
9337409 9721220 |
| RefSeq identity: |
NM_003068 |
| Classification: |
Zinc fingers C2H2-type SNAG transcriptional repressors |
| Havana BLAST/BLAT: |
OTTHUMG00000149912 |