| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
MDM4 / MDMX |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the MDM4 antibody should be determined by the researcher |
| Intented use: |
This MDM4 antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O15151 |
| Purity: |
Antigen affinity |
| Description: |
Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, Both proteins bind the p53 tumor suppressor protein and inhibit its activity, However, So this protein can reverse MDM2-targeted degradation of p53, This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, This protein also interacts with MDM2 protein via the RING finger domain, and have been shown to be overexpressed in a variety of human cancers, and inhibits the latter's degradation, and shows structural similarity to p53-binding protein MDM2, this protein inhibits p53 by binding its transcriptional activation domain, unlike MDM2 which degrades p53, while maintaining suppression of p53 transactivation and apoptotic functions, Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene |
| Immunogen: |
Amino acids KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH of human MDM4 were used as the immunogen for the MDM4 antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MDM4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
MDM4 / MDMX |
| Short name: |
MDM4 Antibody / MDMX |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Mdm4 p53 binding protein homolog (mouse) (Antibody to) / MDMX |
| Alternative technique: |
antibodies |
| Alternative to gene target: |
BT, HDMX and MDMX and MRP1, MDM4 and IDBG-106054 and ENSG00000198625 and 4194, Mdm4 and IDBG-192393 and ENSMUSG00000054387 and 102641776, enzyme binding, nuclei, signal transduction by p53 class mediator and biological process this GO :0042177 and negative regulation of protein catabolic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0045023 and G0 to G1 transition and biological process this GO :0050821 and protein stabilization and biological process this GO :0071157 and negative regulation of cell cycle arrest and biological process this GO :0071456 and cellular response to hypoxia and biological process, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0006461 and protein complex assembly and biological process this GO :0008270 and zinc ion binding and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0019899 and enzyme binding and molecular function this GO :0030330 and DNA damage response, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0019899 : enzyme binding, this GO :0008270 : zinc ion binding, this GO :0019899 : enzyme binding, 17248, 36413 and IDBG-628663 and ENSBTAG00000006255 and 100138492, 514225, Mdm4 p53 binding protein homolog (mouse) |
| Identity: |
6974 |
| Gene: |
MDM4 |
More about : MDM4 |
| Long gene name: |
MDM4, p53 regulator |
| Synonyms gene name: |
human homolog of, mouse double minute 4, p53 binding protein (mouse) Mdm4 p53 binding protein homolog (mouse) , p53-binding protein Mdm4, transformed 3T3 cell double minute 4 |
| Synonyms: |
MDMX HDMX |
| Locus: |
1q32, 1 |
| Discovery year: |
1997-09-05 |
| GenBank acession: |
AF007111 |
| Entrez gene record: |
4194 |
| Pubmed identfication: |
9226370 14660608 |
| RefSeq identity: |
NM_002393 |
| Havana BLAST/BLAT: |
OTTHUMG00000035877 |