MDM4 Antibody / MDMX

Contact us
Catalog number: R31805
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: MDM4 Antibody / MDMX
Quantity: 100ul
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: MDM4 / MDMX
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus) , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the MDM4 antibody should be determined by the researcher
Intented use: This MDM4 antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O15151
Purity: Antigen affinity
Description: Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, Both proteins bind the p53 tumor suppressor protein and inhibit its activity, However, So this protein can reverse MDM2-targeted degradation of p53, This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, This protein also interacts with MDM2 protein via the RING finger domain, and have been shown to be overexpressed in a variety of human cancers, and inhibits the latter's degradation, and shows structural similarity to p53-binding protein MDM2, this protein inhibits p53 by binding its transcriptional activation domain, unlike MDM2 which degrades p53, while maintaining suppression of p53 transactivation and apoptotic functions, Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene
Immunogen: Amino acids KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH of human MDM4 were used as the immunogen for the MDM4 antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the MDM4 antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: MDM4 / MDMX
Short name: MDM4 Antibody / MDMX
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: Mdm4 p53 binding protein homolog (mouse) (Antibody to) / MDMX
Alternative technique: antibodies
Alternative to gene target: BT, HDMX and MDMX and MRP1, MDM4 and IDBG-106054 and ENSG00000198625 and 4194, Mdm4 and IDBG-192393 and ENSMUSG00000054387 and 102641776, enzyme binding, nuclei, signal transduction by p53 class mediator and biological process this GO :0042177 and negative regulation of protein catabolic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0045023 and G0 to G1 transition and biological process this GO :0050821 and protein stabilization and biological process this GO :0071157 and negative regulation of cell cycle arrest and biological process this GO :0071456 and cellular response to hypoxia and biological process, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0006461 and protein complex assembly and biological process this GO :0008270 and zinc ion binding and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0019899 and enzyme binding and molecular function this GO :0030330 and DNA damage response, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008270 : zinc ion binding and also this GO :0019899 : enzyme binding, this GO :0008270 : zinc ion binding, this GO :0019899 : enzyme binding, 17248, 36413 and IDBG-628663 and ENSBTAG00000006255 and 100138492, 514225, Mdm4 p53 binding protein homolog (mouse)
Identity: 6974
Gene: MDM4 | More about : MDM4
Long gene name: MDM4, p53 regulator
Synonyms gene name: human homolog of, mouse double minute 4, p53 binding protein (mouse) Mdm4 p53 binding protein homolog (mouse) , p53-binding protein Mdm4, transformed 3T3 cell double minute 4
Synonyms: MDMX HDMX
Locus: 1q32, 1
Discovery year: 1997-09-05
GenBank acession: AF007111
Entrez gene record: 4194
Pubmed identfication: 9226370 14660608
RefSeq identity: NM_002393
Havana BLAST/BLAT: OTTHUMG00000035877

Related Products :

MBS617015 HdmX (MDM4, HdmX, MdmX -Hdm4, Homolog of Mouse Double Minute 4 Protein) Antibody 100ug 785 € MBS Polyclonals_1 mouse
R31805 MDM4 Antibody / MDMX 0.1mg 406 € NJS poly human
GENTAUR-58bde7eed0535 Mouse Monoclonal [clone 2D10F4] (IgG1) to Human MDM4 / MDMX Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58bde836c7c9b Mouse Monoclonal [clone 4G5] (IgG2b) to Human MDM4 / MDMX Antibody 0.05 ml 597 € MBS mono human
RP-1706H Recombinant Human MDM4 / MDMX Protein (His Tag) 10μg 456 € adv human
GENTAUR-58bca12454c3c Human Protein Mdm4 (MDM4) 100ug 2359 € MBS Recombinant Proteins human
GENTAUR-58bca124a78b6 Human Protein Mdm4 (MDM4) 1000ug 2359 € MBS Recombinant Proteins human
GENTAUR-58bca124e309d Human Protein Mdm4 (MDM4) 100ug 2873 € MBS Recombinant Proteins human
GENTAUR-58bca12538e08 Human Protein Mdm4 (MDM4) 1000ug 2873 € MBS Recombinant Proteins human
GENTAUR-58ba9cca6ba69 Mouse Protein Mdm4 (Mdm4) 100ug 2354 € MBS Recombinant Proteins mouse
GENTAUR-58ba9ccad15bd Mouse Protein Mdm4 (Mdm4) 1000ug 2354 € MBS Recombinant Proteins mouse
GENTAUR-58ba9ccb2c061 Mouse Protein Mdm4 (Mdm4) 100ug 2868 € MBS Recombinant Proteins mouse
GENTAUR-58ba9ccbae7f5 Mouse Protein Mdm4 (Mdm4) 1000ug 2868 € MBS Recombinant Proteins mouse
GENTAUR-58be36ca2d2a1 MDMX antibody 100ug 1033 € MBS mono human
A03M0090 anti-MDM4 (Ab-367) Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AM06258SU-N anti-MDM4 Antibody 0,1 ml 630 € acr human
AM33170PU-N anti-MDM4 Antibody 50 Вµl 732 € acr human
B8369-1 anti-MDM4 Antibody 50 Вµg 347 € acr human
B8369-2 anti-MDM4 Antibody 0,1 mg 500 € acr human
abx216772 Anti-MDM4 Antibody inquire 50 € abbex human
A03M0091 anti-MDM4 (Phospho-Ser367) Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AM26541AF-S anti-MDM4 pSer367 Antibody 50 Вµg 645 € acr human
GWB-ASC978 Human MDM4 (Ab-367) Antibody bulk Ask price € genways bulk human
GWB-ASB994 Human MDM4 (Phospho-Ser367) Antibody bulk Ask price € genways bulk human
GENTAUR-58be4abbbfe90 MDM4 Antibody 100ug 370 € MBS mono human
GWB-92CA28 MDM4 antibody 1 vial 486 € genways human
GWB-A3FB35 MDM4 antibody 1 vial 411 € genways human
bs-7663R-A350 MDM4 ANTIBODY, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7663R-A488 MDM4 ANTIBODY, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-7663R-A555 MDM4 ANTIBODY, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human