SLC10A1 Antibody / NTCP

Contact us
Catalog number: R31795
Price: 406 €
Supplier: NJS poly
Product name: SLC10A1 Antibody / NTCP
Quantity: 0.1mg
Related search:

More details :

Category: Antibody
Concentration: 2ml sterile DI water, 5mg/ml if reconstituted with 0
Form: Antigen affinity purified
Conjugation: Unconjugated
Clone: Polyclonal antibody
Recognised antigen: SLC10A1 / NTCP
Host animal: Rabbit (Oryctolagus cuniculus)
Clonality: Polyclonal (rabbit origin)
Species reactivity: Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens)
Tested applications: IHC-P, WB
Recommended dilutions: 1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0
Notes: Optimal dilution of the NTCP antibody should be determined by the researcher
Intented use: This NTCP antibodyis to be used only for research purposes and not for diagnostics
Uniprot #: O08705
Purity: Antigen affinity
Description: Ho RH et al, NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids, The hASBT gene is known to be activated by the glucocorticoid receptor (GR), also known as SLC10A1 (Solute carrier family 10, indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity, is the major bile acid uptake system in human hepatocytes, member 1), Na+-taurocholate cotransporting polypeptide (NTCP)
Immunogen: Amino acids EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK of mouse SLC10A1/NTCP were used as the immunogen for the NTCP antibody
Storage: Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the NTCP antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term
Localization: Membrane
Properties: C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°
Gene target: SLC10A1 / NTCP
Short name: SLC10A1 Antibody / NTCP
Technique: antibodies against human proteins, antibodies for, Antibody
Alternative name: SLC10A1 (Antibody to) / NTCP
Alternative technique: antibodies
Identity: 10905
Gene: SLC10A1 | More about : SLC10A1
Long gene name: solute carrier family 10 member 1
Synonyms gene name: member 1 , solute carrier family 10 (sodium/bile acid cotransporter)
Synonyms: NTCP
Synonyms name: Na+/taurocholate cotransporting polypeptide
Locus: 14q24, 1
Discovery year: 1994-02-16
GenBank acession: L21893
Entrez gene record: 6554
Pubmed identfication: 8132774
Classification: Solute carriers
Havana BLAST/BLAT: OTTHUMG00000171236

Related Products :