| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
SLC10A1 / NTCP |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, Mouse (Mus musculus), Rat , we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
IHC-P, WB |
| Recommended dilutions: |
1-0, 5-1ug/ml, 5ug/ml, IHC (Paraffin): 0, Western blot: 0 |
| Notes: |
Optimal dilution of the NTCP antibody should be determined by the researcher |
| Intented use: |
This NTCP antibodyis to be used only for research purposes and not for diagnostics |
| Uniprot #: |
O08705 |
| Purity: |
Antigen affinity |
| Description: |
Ho RH et al, NTCP and the ileal transporter ASBT (apical sodium-dependent bile acid transporter) are two sodium-dependent transporters critical for the enterohepatic circulation of bile acids, The hASBT gene is known to be activated by the glucocorticoid receptor (GR), also known as SLC10A1 (Solute carrier family 10, indicates functionally important polymorphisms in NTCP exist and that the like lihood of being carriers of such polymorphisms is dependent on ethnicity, is the major bile acid uptake system in human hepatocytes, member 1), Na+-taurocholate cotransporting polypeptide (NTCP) |
| Immunogen: |
Amino acids EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK of mouse SLC10A1/NTCP were used as the immunogen for the NTCP antibody |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the NTCP antibody may be kept for up to one month refrigerated at +4 degrees C, After reconstitution, For long-term |
| Localization: |
Membrane |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
SLC10A1 / NTCP |
| Short name: |
SLC10A1 Antibody / NTCP |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
SLC10A1 (Antibody to) / NTCP |
| Alternative technique: |
antibodies |
| Identity: |
10905 |
| Gene: |
SLC10A1 |
More about : SLC10A1 |
| Long gene name: |
solute carrier family 10 member 1 |
| Synonyms gene name: |
member 1 , solute carrier family 10 (sodium/bile acid cotransporter) |
| Synonyms: |
NTCP |
| Synonyms name: |
Na+/taurocholate cotransporting polypeptide |
| Locus: |
14q24, 1 |
| Discovery year: |
1994-02-16 |
| GenBank acession: |
L21893 |
| Entrez gene record: |
6554 |
| Pubmed identfication: |
8132774 |
| Classification: |
Solute carriers |
| Havana BLAST/BLAT: |
OTTHUMG00000171236 |