| Category: |
Antibody |
| Concentration: |
2ml sterile DI water, 5mg/ml if reconstituted with 0 |
| Form: |
Antigen affinity purified |
| Conjugation: |
Unconjugated |
| Clone: |
Polyclonal antibody |
| Recognised antigen: |
Otx2 |
| Host animal: |
Rabbit (Oryctolagus cuniculus) |
| Clonality: |
Polyclonal (rabbit origin) |
| Species reactivity: |
Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur, Human (Homo sapiens) |
| Tested applications: |
WB |
| Recommended dilutions: |
5-1ug/ml, Western blot: 0 |
| Notes: |
Titration of the Otx2 antibody may be required due to differences in protocols and secondary/substrate sensitivity, The stated application concentrations are suggested starting amounts |
| Intented use: |
This Otx2 antibodyis to be used only for research purposes and not for diagnostics |
| Gene ID #: |
5015 |
| Purity: |
Antigen affinity |
| Description: |
Alternative splicing results in multiple transcript variants encoding distinct isoforms, Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6), Otx2 acts as a transcription factor and plays a role in brain, Otx2 is also suspected of having an oncogenic role in medulloblastoma, Pseudogenes of this gene are known to exist on chromosomes two and nine, The OTX2 gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors, The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis, and sensory organ development, craniofacial, Orthodenticle homeobox 2 is also known as CPHD6 or MCOPS5 |
| Immunogen: |
An amino acid sequence from the C-terminus of human Orthodenticle homeobox 2 (DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL) was used as the immunogen for this Otx2 antibody (100% mouse homology) |
| Storage: |
Avoid repeated freezing and thawing, Celcius or lower, Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity, For long-term, Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized, aliquot and store at -20 deg, the Otx2 antibody can be stored for up to one month at 4oC, After reconstitution |
| Properties: |
C, C for long term storage and for short term at + 5°, If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24° |
| Gene target: |
Otx2 |
| Short name: |
Otx2 Antibody |
| Technique: |
antibodies against human proteins, antibodies for, Antibody |
| Alternative name: |
Otx2 (Antibody to) |
| Alternative technique: |
antibodies |
| Identity: |
43906 |
| Gene: |
OTX2-AS1 |
More about : OTX2-AS1 |
| Long gene name: |
OTX2 antisense RNA 1 (head to head) |
| Synonyms gene name: |
OTX2 antisense RNA 1 (non-protein coding) OTX2 antisense RNA 1 |
| Synonyms: |
OTX2OS1 |
| Locus: |
14q22, 3 |
| Discovery year: |
2012-05-01 |
| GenBank acession: |
BC041486 |
| Entrez gene record: |
100309464 |
| Pubmed identfication: |
15703187 |
| RefSeq identity: |
NR_029385 |
| Classification: |
Long non-coding RNAs |
| Havana BLAST/BLAT: |
OTTHUMG00000171304 |