Recombinant Human B7 Homolog 4, B7-H4, VTCN1

Contact us
Catalog number: CR01
Price: 587 €
Supplier: acr
Product name: Recombinant Human B7 Homolog 4, B7-H4, VTCN1
Quantity: 0,4 ml
Other quantities: 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human B7 Homolog 4 is produced by our expression system and the target gene encoding Phe29-Ala258 is expressed
Molecular Weight: 25, 3 kD
UniProt number: Q7Z7D3
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: B7-H4, VTCN1, B7 Homolog 4
Short name: B7-H4, VTCN1, Recombinant B7 Homolog 4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: B7-H4, V-set domain containing T cellular activation inhibitor 1, sapiens B7 Homolog 4, recombinant H
Alternative technique: rec
Alternative to gene target: Cell surfaces, VTCN1 and IDBG-101440 and ENSG00000134258 and 79679, VTCN1 and IDBG-634392 and ENSBTAG00000014466 and 539919, Vtcn1 and IDBG-179327 and ENSMUSG00000051076 and 242122, protein binding, this GO :0001562 and response to protozoan and biological process this GO :0002376 and immune system process and biological process this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0050868 and negative regulation of T cell activation and biological process this GO :0072602 and interleukin-4 secretion and biological process this GO :0072643 and interferon-gamma secretion and biological process this GO :1900042 and positive regulation of interleukin-2 secretion and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, V-set domain containing T cell activation inhibitor 1
Identity: 28873
Gene: VTCN1 | More about : VTCN1
Long gene name: V-set domain containing T-cell activation inhibitor 1
Synonyms gene name: V-set domain containing T cell activation inhibitor 1
Synonyms: B7-H4 FLJ22418 B7S1 B7X B7H4
Synonyms name: B7 family member, H4 B7 superfamily member 1
Locus: 1p13, 1-p12
Discovery year: 2005-02-25
GenBank acession: BX648021
Entrez gene record: 79679
Pubmed identfication: 12818165 12818166
RefSeq identity: NM_024626
Classification: V-set domain containing Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000012118

Related Products :

CR01 Recombinant Human B7 Homolog 4, B7-H4, VTCN1 1 mg 2283 € novo human
abx153493 Anti-Human VTCN1 ELISA Kit inquire 50 € abbex human
abx570985 Anti-Human VTCN1 ELISA Kit inquire 50 € abbex human
DL-VTCN1-Hu Human V-Set Domain Containing T-Cell Activation Inhibitor 1 VTCN1 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bde7b51d41c Mouse Monoclonal [clone H74] (IgG1,k) to Human VTCN1 / B7-H4 Antibody 50ug 597 € MBS mono human
GWB-L46C55 VTCN1, 25-259aa, Human, His tag, E.coli bulk Ask price € genways bulk human
LV356423 VTCN1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdcc8490881 Anti- V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcc8507590 Anti- V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcea2efacc Anti- V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd7acf338c Anti- V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd9f98231a Anti- V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd9f9e2b5c Anti- V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdda7cb7e1a Anti- V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bddd6316f79 Anti- V-Set Domain Containing T-Cell Activation Inhibitor 1 (VTCN1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bde9324ae8b Anti- VTCN1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bde9327f0a0 Anti- VTCN1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0c7a0c311 Anti- VTCN1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0c7a45bbf Anti- VTCN1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be10833276f Anti- VTCN1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be108382c46 Anti- VTCN1 Antibody 0.06 ml 265 € MBS Polyclonals human
abx219340 Anti-VTCN1 Antibody 200 μg 369 € abbex human
AP31843PU-N anti-VTCN1 / B7H4 (153-165) Antibody 0,1 mg 558 € acr human
AR51298PU-N anti-VTCN1 / B7H4 (25-259, His-tag) Antibody 0,5 mg 1109 € acr human
AR51298PU-S anti-VTCN1 / B7H4 (25-259, His-tag) Antibody 0,1 mg 485 € acr human
AM05618FC-N anti-VTCN1 / B7H4 Antibody 0,1 mg 645 € acr human
AM05618PU-L anti-VTCN1 / B7H4 Antibody 0,2 mg 761 € acr human
AM05618PU-N anti-VTCN1 / B7H4 Antibody 0,1 mg 471 € acr human
AM05618RP-N anti-VTCN1 / B7H4 Antibody 100 Tests 746 € acr human
AP54528PU-N anti-VTCN1 / B7H4 (Center) Antibody 0,4 ml 587 € acr human