| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human B7 Homolog 4 is produced by our expression system and the target gene encoding Phe29-Ala258 is expressed |
| Molecular Weight: |
25, 3 kD |
| UniProt number: |
Q7Z7D3 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
B7-H4, VTCN1, B7 Homolog 4 |
| Short name: |
B7-H4, VTCN1, Recombinant B7 Homolog 4 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
B7-H4, V-set domain containing T cellular activation inhibitor 1, sapiens B7 Homolog 4, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Cell surfaces, VTCN1 and IDBG-101440 and ENSG00000134258 and 79679, VTCN1 and IDBG-634392 and ENSBTAG00000014466 and 539919, Vtcn1 and IDBG-179327 and ENSMUSG00000051076 and 242122, protein binding, this GO :0001562 and response to protozoan and biological process this GO :0002376 and immune system process and biological process this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0050868 and negative regulation of T cell activation and biological process this GO :0072602 and interleukin-4 secretion and biological process this GO :0072643 and interferon-gamma secretion and biological process this GO :1900042 and positive regulation of interleukin-2 secretion and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, V-set domain containing T cell activation inhibitor 1 |
| Identity: |
28873 |
| Gene: |
VTCN1 |
More about : VTCN1 |
| Long gene name: |
V-set domain containing T-cell activation inhibitor 1 |
| Synonyms gene name: |
V-set domain containing T cell activation inhibitor 1 |
| Synonyms: |
B7-H4 FLJ22418 B7S1 B7X B7H4 |
| Synonyms name: |
B7 family member, H4 B7 superfamily member 1 |
| Locus: |
1p13, 1-p12 |
| Discovery year: |
2005-02-25 |
| GenBank acession: |
BX648021 |
| Entrez gene record: |
79679 |
| Pubmed identfication: |
12818165 12818166 |
| RefSeq identity: |
NM_024626 |
| Classification: |
V-set domain containing Immunoglobulin like domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000012118 |