Recombinant Rat B7-2, CD86 (C-6His)

Contact us
Catalog number: CP43
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Rat B7-2, CD86 (C-6His)
Quantity: 0.1 mg
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Rat
Source: proteins, Recombinants or rec
Description: Recombinant Rat T-lymphocyte Activation Antigen CD86 is produced by our Mammalian expression system and the target gene encoding Vla29-Lys247 is expressed with a 6His tag at the C-terminus
Molecular Weight: 25, 9 kD
UniProt number: O35531
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VPVKRQAYFNSTAYLPCPFTKAQNISPSELVVFWQDRKKSVLYEHYLGAEKLDNVNAKYLGRTSFDRDNQALRLHNVQIKDTGLYDCFIQQKTPTGSIILQQWETELSVIANFSEPEIEEAQNETRNTGINLTCSSKQGYPKPTKMYFLITNSTNEYGDNMQISQDNVTKLFSVSISLSLPFPDGVYNMTIVCILETESMNISSKPHNMVFSQPQFDRKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
About: Rats , There are less rat- than mouse clones however, Rats are used to make rat monoclonal anti mouse antibodies, Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats, genes from rodents , of the genus 
Latin name: Rattus norvegicus
Group: recombinants
Gene target: CD86 (C-6His), B7-2
Short name: CD86 (C-6His), Recombinant B7-2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Rat
Species: Rats, Rat
Alternative name: CD86 molecule (C-6His), recombinant Rat B7-2
Alternative technique: rec
Alternative to gene target: B7-2 and B7, CD86 and IDBG-52336 and ENSG00000114013 and 942, CD86 and IDBG-633264 and ENSBTAG00000013118 and 414345, Cd86 and IDBG-158071 and ENSMUSG00000022901 and 12524, Cell surfaces, DNA-templated and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0051607 and defense response to virus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071248 and cellular response to metal ion and biological process this GO :0071345 and cellular response to cytokine stimulus and biological process, coreceptor activity, this GO :0001878 and response to yeast and biological process this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002309 and T cell proliferation involved in immune response and biological process this GO :0002668 and negative regulation of T cell anergy and biological process this GO :0004872 and receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007568 and aging and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0034341 and response to interferon-gamma and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0042113 and B cell activation and biological process this GO :0042493 and response to drug and biological process this GO :0043011 and myeloid dendritic cell differentiation and biological process this GO :0043017 and positive regulation of lymphotoxin A biosynthetic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045404 and positive regulation of interleukin-4 biosynthetic process and biological process this GO :0045630 and positive regulation of T-helper 2 cell differentiation and biological process this GO :0045893 and positive regulation of transcription, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0015026 : coreceptor activity, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0015026 : coreceptor activity, 2 and B70 and CD28LG2 and LAB72, CD86 molecule
Identity: 1705
Gene: CD86 | More about : CD86
Long gene name: CD86 molecule
Synonyms gene: CD28LG2
Synonyms gene name: B7-2 antigen) , CD86 antigen (CD28 antigen ligand 2
Synonyms: B7, 2 B7-2
Synonyms name: B-lymphocyte antigen B7-2
Locus: 3q13, 33
Discovery year: 1994-12-07
Entrez gene record: 942
Pubmed identfication: 7513726
RefSeq identity: NM_006889
Classification: Immunoglobulin like domain containing CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000159482

Related Products :

CP43 Recombinant Rat B7-2, CD86 (C-6His) 1 mg 2283 € novo rat
CP41 Recombinant Cynomologous B7-2, CD86 (C-6His) 50 µg 166 € novo human
C404 Recombinant Human B7-2, CD86 (C-6His) 500 µg 1186 € novo human
CP44 Recombinant Mouse B7-2, CD86 (C-6His) 10 µg 100 € novo mouse
CP42 Recombinant Rabbit B7-2, CD86 (C-6His) 500 µg 811 € novo human
RP-2077R Recombinant Rat CD86 / B7-2 Protein (His Tag) 50μg 624 € adv rat
MCD086-PE Rat Monoclonal Anti-Mouse CD86, PE (Clone RMMP-2) (rat IgG2a) 100 tests 550 € adi mouse
MCD086-M Rat Monoclonal Anti-Mouse CD86, Purified (Clone RMMP-2) (rat IgG2a) 100 μg 565 € adi mouse
abx169519 Anti-Human CD86 Protein (Recombinant, 293T Lysate) inquire 50 € abbex human
RP-1059RC Recombinant Cynomolgus CD86 / B7-2 Protein (Fc Tag) 100μg 659 € adv human
RP-1060RC Recombinant Cynomolgus CD86 / B7-2 Protein (His Tag) 100μg 659 € adv human
RP-0373H Recombinant Human CD86 / B7-2 Protein (His & Fc Tag) 100μg 659 € adv human
RP-0372H Recombinant Human CD86 / B7-2 Protein (His Tag) 100μg 659 € adv human
CK79 Recombinant Mouse B7-2, CD86 (C-Fc) 1 mg 1014 € novo mouse
RP-1168M Recombinant Mouse CD86 / B7-2 Protein (His & Fc Tag) 100μg 659 € adv mouse
RP-1169M Recombinant Mouse CD86 / B7-2 Protein (His Tag) 100μg 624 € adv mouse
GENTAUR-58be268ddd5ba Anti-Mouse CD86, PE (Clone RMMP-2) (rat IgG2a) 0.3 miligrams 1818 € MBS mono mouse
GENTAUR-58be268e463c3 Anti-Mouse CD86, PE (Clone RMMP-2) (rat IgG2a) 50ug 475 € MBS mono mouse
GENTAUR-58be267f6dcc8 Anti-Mouse CD86, Purified (Clone RMMP-2) (rat IgG2a) 200ug 437 € MBS mono mouse
BB-EK0712 anti-Rat CD86/ B7-2 ELISA Kit Antibody 96 Tests 717 € acr rat
CEK1588 anti-Rat CD86 ELISA Kit Antibody 96 Tests 703 € acr rat
ACL8986AP CD86, B7-2, B70, Clone: RMMP-2, Rat Mouse Monoclonal antibody-Mouse 0.2mg 385 € accurate-monoclonals mouse
ACL8986APC CD86, B7-2, B70, Clone: RMMP-2, Rat Mouse Monoclonal antibody-Mouse, APC 0.1mg Ask price € accurate-monoclonals mouse
ACL8986B CD86, B7-2, B70, Clone: RMMP-2, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.1mg Ask price € accurate-monoclonals mouse
ACL8986B-3 CD86, B7-2, B70, Clone: RMMP-2, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.3mg Ask price € accurate-monoclonals mouse
ACL8986F CD86, B7-2, B70, Clone: RMMP-2, Rat Mouse Monoclonal antibody-Mouse, FITC 0.1mg Ask price € accurate-monoclonals mouse
ACL8986F-3 CD86, B7-2, B70, Clone: RMMP-2, Rat Mouse Monoclonal antibody-Mouse, FITC 0.3mg Ask price € accurate-monoclonals mouse
ACL8986PE CD86, B7-2, B70, Clone: RMMP-2, Rat Mouse Monoclonal antibody-Mouse, PE 50 ug 406 € accurate-monoclonals mouse
ACL8986PE-3 CD86, B7-2, B70, Clone: RMMP-2, Rat Mouse Monoclonal antibody-Mouse, PE 0.3mg 1876 € accurate-monoclonals mouse
YSRTMCA1962B CD86, B7-2, Clone: 24F, Mouse Monoclonal antibody-Rat, Biotin 0.1 mg Ask price € accurate-monoclonals rat