Recombinant Human B7-2, CD86 (C-6His)

Contact us
Catalog number: C404
Price: 845 €
Supplier: genways
Product name: Recombinant Human B7-2, CD86 (C-6His)
Quantity: 1 vial
Other quantities: 1 mg 1674€ 10 µg 100€ 50 µg 202€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CD86 is produced by our Mammalian expression system and the target gene encoding Ala24-Pro247 is expressed with a 6His tag at the C-terminus
Molecular Weight: 26, 69 kD
UniProt number: P42081
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD86 (C-6His), B7-2
Short name: CD86 (C-6His), Recombinant B7-2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD86 molecule (C-6His), sapiens B7-2, recombinant H
Alternative technique: rec
Alternative to gene target: B7-2 and B7, CD86 and IDBG-52336 and ENSG00000114013 and 942, CD86 and IDBG-633264 and ENSBTAG00000013118 and 414345, Cd86 and IDBG-158071 and ENSMUSG00000022901 and 12524, Cell surfaces, DNA-templated and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0051607 and defense response to virus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071248 and cellular response to metal ion and biological process this GO :0071345 and cellular response to cytokine stimulus and biological process, coreceptor activity, this GO :0001878 and response to yeast and biological process this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002309 and T cell proliferation involved in immune response and biological process this GO :0002668 and negative regulation of T cell anergy and biological process this GO :0004872 and receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007568 and aging and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0034341 and response to interferon-gamma and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0042113 and B cell activation and biological process this GO :0042493 and response to drug and biological process this GO :0043011 and myeloid dendritic cell differentiation and biological process this GO :0043017 and positive regulation of lymphotoxin A biosynthetic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045404 and positive regulation of interleukin-4 biosynthetic process and biological process this GO :0045630 and positive regulation of T-helper 2 cell differentiation and biological process this GO :0045893 and positive regulation of transcription, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0015026 : coreceptor activity, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0015026 : coreceptor activity, 2 and B70 and CD28LG2 and LAB72, CD86 molecule
Identity: 1705
Gene: CD86 | More about : CD86
Long gene name: CD86 molecule
Synonyms gene: CD28LG2
Synonyms gene name: B7-2 antigen) , CD86 antigen (CD28 antigen ligand 2
Synonyms: B7, 2 B7-2
Synonyms name: B-lymphocyte antigen B7-2
Locus: 3q13, 33
Discovery year: 1994-12-07
Entrez gene record: 942
Pubmed identfication: 7513726
RefSeq identity: NM_006889
Classification: Immunoglobulin like domain containing CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000159482

Related Products :

C404 Recombinant Human B7-2, CD86 (C-6His) 500 µg 1186 € novo human
CP41 Recombinant Cynomologous B7-2, CD86 (C-6His) 50 µg 166 € novo human
CP44 Recombinant Mouse B7-2, CD86 (C-6His) 10 µg 100 € novo mouse
CP42 Recombinant Rabbit B7-2, CD86 (C-6His) 500 µg 811 € novo human
CP43 Recombinant Rat B7-2, CD86 (C-6His) 1 mg 2283 € novo rat
abx169519 Anti-Human CD86 Protein (Recombinant, 293T Lysate) inquire 50 € abbex human
RP-0373H Recombinant Human CD86 / B7-2 Protein (His & Fc Tag) 100μg 659 € adv human
RP-0372H Recombinant Human CD86 / B7-2 Protein (His Tag) 100μg 659 € adv human
RP-1059RC Recombinant Cynomolgus CD86 / B7-2 Protein (Fc Tag) 100μg 659 € adv human
RP-1060RC Recombinant Cynomolgus CD86 / B7-2 Protein (His Tag) 100μg 659 € adv human
CK79 Recombinant Mouse B7-2, CD86 (C-Fc) 1 mg 1014 € novo mouse
RP-1168M Recombinant Mouse CD86 / B7-2 Protein (His & Fc Tag) 100μg 659 € adv mouse
RP-1169M Recombinant Mouse CD86 / B7-2 Protein (His Tag) 100μg 624 € adv mouse
RP-2077R Recombinant Rat CD86 / B7-2 Protein (His Tag) 50μg 624 € adv rat
101-M317 Anti-Human CD86 100ug 336 € Reliatech antibodies human
abx253623 Anti-Human T-lymphocyte activation antigen CD86 ELISA Kit 96 tests 586 € abbex human
OBT0391 CD86, B7-2, B-Cell activated, Monocyte, Clone: BU63, Mouse Monoclonal antibody-Human 200ug Ask price € accurate-monoclonals human
OBT0391Z CD86, B7-2, B-Cell activated, Monocyte, Clone: BU63, Mouse Monoclonal antibody-Human 1 mg Ask price € accurate-monoclonals human
OBT0391F CD86, B7-2, B-Cell activated, Monocyte, Clone: BU63, Mouse Monoclonal antibody-Human, FITC; flow 0.1 mg Ask price € accurate-monoclonals human
OBT0391R CD86, B7-2, B-Cell activated, Monocyte, Clone: BU63, Mouse Monoclonal antibody-Human, RPE; flow 100 tests Ask price € accurate-monoclonals human
YSRTMCA1118F CD86, B7-2, Monocyte (circulating), B-Cell activated, Germinal Center Cells, Clone: BU63, Mouse Monoclonal antibody-Human, FITC; flw vial 404 € accurate-monoclonals human
YSRTMCA1118FT CD86, B7-2, Monocyte (circulating), B-Cell activated, Germinal Center Cells, Clone: BU63, Mouse Monoclonal antibody-Human, FITC; flw 25 ug 149 € accurate-monoclonals human
YSRTMCA1118 CD86, B7-2, Monocyte (circulating), B-Cell activated, Germinal Center Cells, Clone: BU63, Mouse Monoclonal antibody-Human; frozen, IH/flw/IP 0.2mg 462 € accurate-monoclonals human
YSRTMCA1118EL CD86, B7-2, Monocyte (circulating), B-Cell activated, Germinal Center Cells, Clone: BU63, Mouse Monoclonal antibody-Human; frozen, IH/flw/IP 0.5 mg 617 € accurate-monoclonals human
YSRTMCA1118T CD86, B7-2, Monocyte (circulating), B-Cell activated, Germinal Center Cells, Clone: BU63, Mouse Monoclonal antibody-Human; frozen, IH/flw/IP 25 ug 119 € accurate-monoclonals human
YSRTMCA1118C CD86, B7-2, Monocyte (circulating), B-Cell activated, Germinal Center Cells, Clone: BU63, Mouse Monoclonal antibody-Human; frozen, IH/flw/IP, RPE-Cy5 500ul 704 € accurate-monoclonals human
YSRTMCA1118PE CD86, B7-2, Monocyte (circulating), B-Cell activated, Germinal Center Cells, Clone: BU63, Mouse Monoclonal antibody-Human, RPE; flw vial 432 € accurate-monoclonals human
YSRTMCA1118PET CD86, B7-2, Monocyte (circulating), B-Cell activated, Germinal Center Cells, Clone: BU63, Mouse Monoclonal antibody-Human, RPE; flw vial 177 € accurate-monoclonals human
GWB-EE0C29 CD86/BY-2 Human, antibody 1 vial 845 € genways human
GWB-D1C2AF CD86/BY-2 Human -FITC conjugated, antibody 1 vial 845 € genways human