| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
IGF-1 acts via specific receptor, IGF-1R, IGF-II, Insulin-like growth factor -1 shares structural homology with proinsulin and is mainly produced by liver, Raf/Ras and PI3K cascades, a heterodimeric tyrosine kinase receptor that signals to various second messenger pathways such as MAPK, insulin-like growth factors -1 and -2 are important regulators of signaling that mediates growth and metabolism in cells, IGF-I |
| Molecular Weight: |
1 kD, 9 |
| UniProt number: |
P05019 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 6, 2 um filtered solution of 300 mM HAc-NaAc, 5, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
LR3 1 (MG), LR3 Insulin-Like Growth Factor I |
| Short name: |
LR3-IGF-1 (MG), Recombinant LR3 Insulin-Like Growth Factor I |
| Technique: |
E, coli recombinant proteins are , igfs, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
LR3-IGF-1 (MG), sapiens LR3 Insulin-Like Growth Factor I, recombinant H |
| Alternative technique: |
rec |
| Identity: |
6697 |
| Gene: |
LRP5 |
More about : LRP5 |
| Long gene name: |
LDL receptor related protein 5 |
| Synonyms gene: |
LRP7 OPPG EVR1 |
| Synonyms gene name: |
osteoporosis pseudoglioma syndrome exudative vitreoretinopathy 1 low density lipoprotein receptor-related protein 5 |
| Synonyms: |
LR3 BMND1 HBM OPS OPTA1 VBCH2 EVR4 |
| Locus: |
11q13, 2 |
| Discovery year: |
1998-04-07 |
| GenBank acession: |
AF064548 |
| Entrez gene record: |
4041 |
| Pubmed identfication: |
9714764 10049586 |
| RefSeq identity: |
NM_002335 |
| Classification: |
Low density lipoprotein receptors |
| Havana BLAST/BLAT: |
OTTHUMG00000167570 |
| Locus Specific Databases: |
LOVD - Leiden Open Variation Database |