Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1

Contact us
Catalog number: C032
Price: 50 €
Supplier: abbex
Product name: Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1
Quantity: inquire
Other quantities: 1 mg 1014€ 10 µg 80€ 50 µg 141€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: IGF-1 acts via specific receptor, IGF-1R, IGF-II, Insulin-like growth factor -1 shares structural homology with proinsulin and is mainly produced by liver, Raf/Ras and PI3K cascades, a heterodimeric tyrosine kinase receptor that signals to various second messenger pathways such as MAPK, insulin-like growth factors -1 and -2 are important regulators of signaling that mediates growth and metabolism in cells, IGF-I
Molecular Weight: 6 kD, 7
UniProt number: P05019
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 6, 2 um filtered solution of 300 mM NaAc, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: I, IGF1, Insulin-Like Growth Factor I
Short name: IGF-I, IGF1, Recombinant Insulin-Like Growth Factor I
Technique: E, coli recombinant proteins are , igfs, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: IGF-I, insulin-like growth factor 1 (somatomedin C), sapiens Insulin-Like Growth Factor I, recombinant H
Alternative technique: rec
Alternative to gene target: DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046326 and positive regulation of glucose import and biological process this GO :0046579 and positive regulation of Ras protein signal transduction and biological process this GO :0048009 and insulin-like growth factor receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0048286 and lung alveolus development and biological process this GO :0048468 and cell development and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0048754 and branching morphogenesis of an epithelial tube and biological process this GO :0048839 and inner ear development and biological process this GO :0050650 and chondroitin sulfate proteoglycan biosynthetic process and biological process this GO :0050679 and positive regulation of epithelial cell proliferation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0051246 and regulation of protein metabolic process and biological process this GO :0051450 and myoblast proliferation and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0060426 and lung vasculature development and biological process this GO :0060463 and lung lobe morphogenesis and biological process this GO :0060509 and Type I pneumocyte differentiation and biological process this GO :0060510 and Type II pneumocyte differentiation and biological process this GO :0060527 and prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis and biological process this GO :0060736 and prostate gland growth and biological process this GO :0060740 and prostate gland epithelium morphogenesis and biological process this GO :0060741 and prostate gland stromal morphogenesis and biological process this GO :0060766 and negative regulation of androgen receptor signaling pathway and biological process this GO :0070373 and negative regulation of ERK1 and ERK2 cascade and biological process this GO :0070886 and positive regulation of calcineurin-NFAT signaling cascade and biological process this GO :0090201 and negative regulation of release of cytochrome c from mitochondria and biological process this GO :0097192 and extrinsic apoptotic signaling pathway in absence of ligand and biological process this GO :2000288 and positive regulation of myoblast proliferation and biological process this GO :2001237 and negative regulation of extrinsic apoptotic signaling pathway and biological process, Extracellular, IGF-I and IGF1A and IGFI, IGF1 and IDBG-53609 and ENSG00000017427 and 3479, IGF1 and IDBG-637164 and ENSBTAG00000011082 and 281239, Igf1 and IDBG-182955 and ENSMUSG00000020053 and 16000, growth factor activity, this GO :0001501 and skeletal system development and biological process this GO :0001775 and cell activation and biological process this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0001974 and blood vessel remodeling and biological process this GO :0002576 and platelet degranulation and biological process this GO :0005158 and insulin receptor binding and molecular function this GO :0005159 and insulin-like growth factor receptor binding and molecular function this GO :0005178 and integrin binding and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006260 and DNA replication and biological process this GO :0006928 and cellular component movement and biological process this GO :0007165 and signal transduction and biological process this GO :0007265 and Ras protein signal transduction and biological process this GO :0007399 and nervous system development and biological process this GO :0007517 and muscle organ development and biological process this GO :0007596 and blood coagulation and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009441 and glycolate metabolic process and biological process this GO :0010001 and glial cell differentiation and biological process this GO :0010613 and positive regulation of cardiac muscle hypertrophy and biological process this GO :0014068 and positive regulation of phosphatidylinositol 3-kinase signaling and biological process this GO :0014834 and skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration and biological process this GO :0014896 and muscle hypertrophy and biological process this GO :0014904 and myotube cell development and biological process this GO :0014911 and positive regulation of smooth muscle cell migration and biological process this GO :0016942 and insulin-like growth factor binding protein complex and cellular component this GO :0021940 and positive regulation of cerebellar granule cell precursor proliferation and biological process this GO :0030104 and water homeostasis and biological process this GO :0030166 and proteoglycan biosynthetic process and biological process this GO :0030168 and platelet activation and biological process this GO :0030324 and lung development and biological process this GO :0030879 and mammary gland development and biological process this GO :0031017 and exocrine pancreas development and biological process this GO :0031093 and platelet alpha granule lumen and cellular component this GO :0032878 and regulation of establishment or maintenance of cell polarity and biological process this GO :0033160 and positive regulation of protein import into nucleus, this GO :0005158 : insulin receptor binding, this GO :0005158 : insulin receptor binding and also this GO :0005159 : insulin-like growth factor receptor binding and also this GO :0005178 : integrin binding and also this GO :0005179 : hormone activity and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity, this GO :0005159 : insulin-like growth factor receptor binding, this GO :0005178 : integrin binding, this GO :0005179 : hormone activity, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, translocation and biological process this GO :0034392 and negative regulation of smooth muscle cell apoptotic process and biological process this GO :0035264 and multicellular organism growth and biological process this GO :0035630 and bone mineralization involved in bone maturation and biological process this GO :0040014 and regulation of multicellular organism growth and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042523 and positive regulation of tyrosine phosphorylation of Stat5 protein and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043388 and positive regulation of DNA binding and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0043568 and positive regulation of insulin-like growth factor receptor signaling pathway and biological process this GO :0044267 and cellular protein metabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045445 and myoblast differentiation and biological process this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0045725 and positive regulation of glycogen biosynthetic process and biological process this GO :0045740 and positive regulation of DNA replication and biological process this GO :0045821 and positive regulation of glycolytic process and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045893 and positive regulation of transcription, insulin-like growth factor 1 (somatomedin C)
Identity: 5464
Gene: IGF1 | More about : IGF1
Long gene name: insulin like growth factor 1
Synonyms gene name: insulin-like growth factor 1 (somatomedin C)
Synonyms: IGF1A IGFI IGF-I
Synonyms name: somatomedin C
Locus: 12q23, 2
Discovery year: 1986-01-01
GenBank acession: X00173
Entrez gene record: 3479
Pubmed identfication: 2982726 6358902
RefSeq identity: NM_000618
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000149910
Locus Specific Databases: LOVD - Leiden Open Variation Database

Related Products :

C031 Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1 (4-70) 1 mg 608 € novo human
C032 Recombinant Human Insulin-Like Growth Factor I, IGF-I, IGF1 500 µg 659 € novo human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
abx260526 Anti-Fish Insulin Like Growth Factor 1 (IGF1) Protein (Recombinant) 10 µg 238 € abbex fish
abx166372 Anti-Insulin Like Growth Factor 1 (IGF1) Protein (Recombinant) 100 μg 949 € abbex human
abx166424 Anti-Insulin Like Growth Factor 1 (IGF1) Protein (Recombinant) 10 μg 354 € abbex human
abx167556 Anti-Insulin Like Growth Factor 1 (IGF1) Protein (Recombinant) 100 μg 949 € abbex human
abx260488 Anti-Insulin Like Growth Factor 1 (IGF1) Protein (Recombinant) 10 µg 238 € abbex human
abx260489 Anti-Insulin Like Growth Factor 1 (IGF1) Protein (Recombinant) 1 mg 456 € abbex human
abx263464 Anti-Insulin Like Growth Factor 1 (IGF1) Protein (Recombinant) 1 mg 1746 € abbex human
abx263512 Anti-Insulin Like Growth Factor 1 (IGF1) Protein (Recombinant) 1 mg 1862 € abbex human
GWB-DAF53F Insulin-Like Growth Factor-I (IGF-I) recombinant Human 1 vial 1272 € genways human
IGF16-R-10 Recombinant (E.coli) purified Human Insulin Like Growth Factor-1 (IGF-1) protein 10 μg 405 € adi human
IGF26-R-10 Recombinant (E.coli) purified Human Insulin Like Growth Factor-2 (IGF-2) protein 10 μg 405 € adi human
C023 Recombinant Human LR3 Insulin-Like Growth Factor I, LR3-IGF-1 (MG) 500 µg 440 € novo human
IGF15-R-10 Recombinant (E.coli) purified Mouse Insulin Like Growth Factor-1 (IGF-1) protein 10 μg 405 € adi mouse
abx190051 Anti-Human Insulin Like Growth Factor 1 (IGF1) CLIA Kit inquire 50 € abbex human
abx151906 Anti-Human Insulin Like Growth Factor 1 (IGF1) ELISA Kit inquire 50 € abbex human
abx250944 Anti-Human Insulin Like Growth Factor 1 (IGF1) ELISA Kit 96 tests 557 € abbex human
abx573274 Anti-Human Insulin Like Growth Factor 1 (IGF1) ELISA Kit inquire 50 € abbex human
AP50009HU Human Insulin Like Growth Factor 1 (IGF1) 0.5mg 531 € AbELISA Rec human
DL-IGF1-Hu Human Insulin Like Growth Factor 1 IGF1 ELISA Kit 96T 568 € DL elisas human
GENTAUR-58b856ffec876 Human Insulin-like growth factor I (IGF1) 100ug 1288 € MBS Recombinant Proteins human
GENTAUR-58b8570052a2a Human Insulin-like growth factor I (IGF1) 1000ug 1288 € MBS Recombinant Proteins human
GENTAUR-58b85700be146 Human Insulin-like growth factor I (IGF1) 100ug 1796 € MBS Recombinant Proteins human
GENTAUR-58b8570128b0f Human Insulin-like growth factor I (IGF1) 1000ug 1796 € MBS Recombinant Proteins human
abx150021 Anti-Chicken Insulin Like Growth Factor 1 (IGF1) ELISA Kit inquire 50 € abbex chicken
abx575064 Anti-Chicken Insulin Like Growth Factor 1 (IGF1) ELISA Kit inquire 50 € abbex chicken
abx190850 Anti-Cow Insulin Like Growth Factor 1 (IGF1) CLIA Kit inquire 50 € abbex cow
abx150119 Anti-Cow Insulin Like Growth Factor 1 (IGF1) ELISA Kit inquire 50 € abbex cow