| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse V-set and Immunoglobulin Domain-containing Protein 8 is produced by our Mammalian expression system and the target gene encoding Val22-Gly262 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
27, 6 kD |
| UniProt number: |
Q6P3A4 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
10% Glycerol, pH7, 2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVGHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
VSIG8 (C-6His), V-Set Ig Domain Protein 8 |
| Short name: |
VSIG8 (C-6His), Recombinant Mouse V-Set Ig Domain- Protein 8 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
V-set and immunoglobulin domain containing 8 (C-6His), recombinant Mouse V-Set and Ig Domain-Containing Protein 8 |
| Alternative technique: |
rec |
| Alternative to gene target: |
Plasma membranes, VSIG8 and IDBG-409230 and ENSG00000243284 and 391123, VSIG8 and IDBG-630698 and ENSBTAG00000010670 and 520493, Vsig8 and IDBG-205594 and ENSMUSG00000049598 and 240916, poly(A) RNA binding, this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0044822 and poly(A) RNA binding and molecular function, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0044822 : poly(A) RNA binding, this GO :0044822 : poly(A) RNA binding, V-set and immunoglobulin domain containing 8 |
| Identity: |
32063 |
| Gene: |
VSIG8 |
More about : VSIG8 |
| Long gene name: |
V-set and immunoglobulin domain containing 8 |
| Locus: |
1q23, 2 |
| Discovery year: |
2005-12-01 |
| Entrez gene record: |
391123 |
| RefSeq identity: |
NM_001013661 |
| Classification: |
V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000168834 |