| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Leukocyte Immunoglobulin-like Receptor Subfamily B Member 4 is produced by our Mammalian expression system and the target gene encoding Gly24-Lys238 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
24, 9 kD |
| UniProt number: |
Q64281 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD85k, ILT3 (C-6His), LILRB4 |
| Short name: |
CD85k, ILT3 (C-6His), Recombinant Mouse LILRB4 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD85k, ILT3 (C-6His), member 4, subfamily B (including TM and ITIM domains), recombinant Mouse leukocyte immunoglobulin-like receptor |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD85K and ILT-3 and ILT3 and LIR-5 and LIR5, LILRB4 and IDBG-68893 and ENSG00000186818 and 11006, Plasma membranes, member 4, protein binding, subfamily B (with TM and ITIM domains), this GO :0002376 and immune system process and biological process this GO :0003823 and antigen binding and molecular function this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007165 and signal transduction and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0045671 and negative regulation of osteoclast differentiation and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0003823 : antigen binding, this GO :0003823 : antigen binding and also this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0004872 : receptor activity, this GO :0005515 : protein binding, leukocyte immunoglobulin-like receptor |
| Identity: |
6608 |
| Gene: |
LILRB4 |
More about : LILRB4 |
| Long gene name: |
leukocyte immunoglobulin like receptor B4 |
| Synonyms gene name: |
leukocyte immunoglobulin-like receptor, member 4 , subfamily B (with TM and ITIM domains) |
| Synonyms: |
LIR-5 ILT3 HM18 LIR5 CD85k |
| Synonyms name: |
leucocyte Ig-like receptor B4 |
| Locus: |
19q13, 42 |
| Discovery year: |
2000-01-11 |
| GenBank acession: |
U82979 |
| Entrez gene record: |
11006 |
| Pubmed identfication: |
9151699 9079806 |
| Classification: |
Inhibitory leukocyte immunoglobulin like receptors CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000065879 |