Recombinant Mouse Interleukin-21 Receptor, IL-21R (C-6His)

Contact us
Catalog number: CS91
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: Recombinant Mouse Interleukin-21 Receptor, IL-21R (C-6His)
Quantity: 100ul
Other quantities: 1 mg 912€ 10 µg 100€ 50 µg 202€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-21 Receptor is produced by our Mammalian expression system and the target gene encoding Cys20-Pro236 is expressed with a 6His tag at the C-terminus
Molecular Weight: 25, 7 kD
UniProt number: Q9JHX3
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDPHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-21R (C-6His), Interleukin-21 Receptor
Short name: IL-21R (C-6His), Recombinant Mouse Interleukin-21 Receptor
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Interleukin-21R (C-6His), recombinant Mouse Interleukin-21 Receptor
Alternative technique: rec

Related Products :

MBS610275 Interleukin 21R, ED (IL-21R ED) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS615857 Interleukin 21R, NT (IL-21R NT) Antibody 100ug 536 € MBS Polyclonals_1 human
CS91 Recombinant Mouse Interleukin-21 Receptor, IL-21R (C-6His) 1 mg 912 € novo mouse
CC81 Recombinant Human IL-21 Receptor, IL-21R (C-6His) 10 µg 95 € novo human
RP-0895H Recombinant Human IL-21R / Interleukin-21 Receptor Protein (His Tag) 100μg 624 € adv human
RP-2179R Recombinant Rat IL-21R / Interleukin-21 Receptor Protein (His Tag) 50μg 624 € adv rat
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
CC23 Recombinant Mouse Interleukin-5 Receptor Subunit Alpha, IL-5 Rα (C-6His) 500 µg 1613 € novo human
CS32 Recombinant Human Interleukin-13 Receptor Subunit Alpha-1, IL-13RA1(C-6His) 500 µg 659 € novo human
CS33 Recombinant Human Interleukin-4 Receptor Subunit Alpha, IL-4 Rα(C-6His) 1 mg 1877 € novo human
CS70 Recombinant Human Interleukin-5 Receptor Subunit Alpha, IL-5 Rα(C-6His) 10 µg 202 € novo human
GENTAUR-58bab80d4cd5d African swine fever virus Protein MGF 360-21R (Ken-169) 100ug 2033 € MBS Recombinant Proteins human
GENTAUR-58bab80dc763e African swine fever virus Protein MGF 360-21R (Ken-169) 1000ug 2033 € MBS Recombinant Proteins human
GENTAUR-58bab80e31d60 African swine fever virus Protein MGF 360-21R (Ken-169) 100ug 2547 € MBS Recombinant Proteins human
GENTAUR-58bab80eba887 African swine fever virus Protein MGF 360-21R (Ken-169) 1000ug 2547 € MBS Recombinant Proteins human
GENTAUR-58bab8cbb2a31 African swine fever virus Protein MGF 360-21R (Ken-169) 100ug 2033 € MBS Recombinant Proteins human
GENTAUR-58bab8cbeaac6 African swine fever virus Protein MGF 360-21R (Ken-169) 1000ug 2033 € MBS Recombinant Proteins human
GENTAUR-58bab8cc38b10 African swine fever virus Protein MGF 360-21R (Ken-169) 100ug 2547 € MBS Recombinant Proteins human
GENTAUR-58bab8cc7a334 African swine fever virus Protein MGF 360-21R (Ken-169) 1000ug 2547 € MBS Recombinant Proteins human
GENTAUR-58bc52f681440 African swine fever virus Protein MGF 360-21R (Mal-001) 100ug 1890 € MBS Recombinant Proteins human
GENTAUR-58bc52f6d5e02 African swine fever virus Protein MGF 360-21R (Mal-001) 1000ug 1890 € MBS Recombinant Proteins human
GENTAUR-58bc52f72a4f0 African swine fever virus Protein MGF 360-21R (Mal-001) 100ug 2404 € MBS Recombinant Proteins human
GENTAUR-58bc52f760efb African swine fever virus Protein MGF 360-21R (Mal-001) 1000ug 2404 € MBS Recombinant Proteins human
GENTAUR-58ba0fac22eaf African swine fever virus Protein MGF 360-21R (Pret-175) 100ug 2033 € MBS Recombinant Proteins human
GENTAUR-58ba0fad18093 African swine fever virus Protein MGF 360-21R (Pret-175) 1000ug 2033 € MBS Recombinant Proteins human
GENTAUR-58ba0fad856c1 African swine fever virus Protein MGF 360-21R (Pret-175) 100ug 2547 € MBS Recombinant Proteins human
GENTAUR-58ba0fae67a65 African swine fever virus Protein MGF 360-21R (Pret-175) 1000ug 2547 € MBS Recombinant Proteins human
GENTAUR-58be60dcd2eea Anti-IL-21R (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-2622R-A350 IL-21R Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2622R-A488 IL-21R Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human