| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Low Affinity Immunoglobulin Gamma Fc Region Receptor IV is produced by our Mammalian expression system and the target gene encoding Gly21-Gln203 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
21, 9 kD |
| UniProt number: |
Q8R2R4 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYSQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, CD16-2 (C-6His) by novo by chromatographic size exclusion, FcgR4, Mouse are mature after 40 days for females and 55 days for males, Mouse , SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, A high affinity purification column was use to purify Recombinant Mouse Low IgG Fc Receptor IV, mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| About: |
2 light chains, For storage sodium azide is added or you can call us to request azide free antibody preparations, IgG, The IgG antibody has 2 , There are 2 heavy chains, These will need colder storage temperatures, They represent 70% or more of , This antibody can be antigen purified or protein A or G purified, goat polyclonal antibodies , mouse monoclonal H&, Immunoglobulin gamma, L chain clones or rabbit, antibodies, antigen , binding sites, have 4 parts, serum |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD16-2 (C-6His), FcgR4, Fc Receptor IV |
| Short name: |
CD16-2 (C-6His), FcgR4, Recombinant Mouse Low IgG Fc Receptor IV |
| Technique: |
E, IgGs, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Isotype: |
IgG |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD16-2 (C-6His), FcgR4, recombinant Mouse Low protein Immunoglobulin G fragment c Receptor IV |
| Alternative technique: |
rec |