Recombinant Mouse Low Affinity IgG Fc Receptor IV, FcgR4, CD16-2 (C-6His)

Contact us
Catalog number: CS21
Price: 580 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse Low Affinity IgG Fc Receptor IV, FcgR4, CD16-2 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Low Affinity Immunoglobulin Gamma Fc Region Receptor IV is produced by our Mammalian expression system and the target gene encoding Gly21-Gln203 is expressed with a 6His tag at the C-terminus
Molecular Weight: 21, 9 kD
UniProt number: Q8R2R4
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYSQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, CD16-2 (C-6His) by novo by chromatographic size exclusion, FcgR4, Mouse are mature after 40 days for females and 55 days for males, Mouse , SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, A high affinity purification column was use to purify Recombinant Mouse Low IgG Fc Receptor IV, mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
About: 2 light chains, For storage sodium azide is added or you can call us to request azide free antibody preparations, IgG, The IgG antibody has 2 , There are 2 heavy chains, These will need colder storage temperatures, They represent 70% or more of , This antibody can be antigen purified or protein A or G purified, goat polyclonal antibodies , mouse monoclonal H&, Immunoglobulin gamma, L chain clones or rabbit, antibodies, antigen , binding sites, have 4 parts, serum 
Latin name: Mus musculus
Group: recombinants
Gene target: CD16-2 (C-6His), FcgR4, Fc Receptor IV
Short name: CD16-2 (C-6His), FcgR4, Recombinant Mouse Low IgG Fc Receptor IV
Technique: E, IgGs, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Isotype: IgG
Species: Mouses, Mouse
Alternative name: CD16-2 (C-6His), FcgR4, recombinant Mouse Low protein Immunoglobulin G fragment c Receptor IV
Alternative technique: rec

Related Products :

CS21 Recombinant Mouse Low Affinity IgG Fc Receptor IV, FcgR4, CD16-2 (C-6His) 50 µg 303 € novo mouse
RP-1638M Recombinant Mouse CD16-2 / FCGR4 Protein (His & AVI Tag) 50μg 624 € adv mouse
MBS612244 Nerve Growth Factor Receptor, p75 (NGFR, NGF Receptor, CD271, Gp80 LNGFR, Low Affinity Nerve Growth Factor Receptor, Low Affinity Neurotrophin Receptor p75 NTR, p75 ICD, p75 Neurotrophin, p75 NTR, Tumor Necrosis Factor Receptor Superfamily Member 16, TNFR Antibody 100ug 591 € MBS Polyclonals_1 human
OBT1106B CD16, FcγRIII (low affinity), Clone: GRM1, Mouse Monoclonal antibody-Human, Biotin; cell suspensions/frozen, IH/WB 100 tests Ask price € accurate-monoclonals human
OBT1106 CD16, FcγRIII (low affinity), Clone: GRM1, Mouse Monoclonal antibody-Human; cell suspensions/frozen, IH/WB 0.1 mg Ask price € accurate-monoclonals human
OBT1106F CD16, FcγRIII (low affinity), Clone: GRM1, Mouse Monoclonal antibody-Human, FITC; cell suspensions/frozen, IH/WB 100 tests Ask price € accurate-monoclonals human
OBT1106R CD16, FcγRIII (low affinity), Clone: GRM1, Mouse Monoclonal antibody-Human, RPE; cell suspensions/frozen, IH 100 tests Ask price € accurate-monoclonals human
OBT1106RC CD16, FcγRIII (low affinity), Clone: GRM1, Mouse Monoclonal antibody-Human, RPE-Cy5; flow 100 tests Ask price € accurate-monoclonals human
YM1041A CD16, FcγRIII (low affinity), Gran, Macro, NK Cell, 50-70kD, Clone: BL-LGL/1, Mouse Monoclonal antibody-Human; NO paraffin 1000ul Ask price € accurate-monoclonals human
YM1041B CD16, FcγRIII (low affinity), Gran, Macro, NK Cell, 50-70kD, Clone: BL-LGL/2, Mouse Monoclonal antibody-Human; NO paraffin 1000ul Ask price € accurate-monoclonals human
YM1041C CD16, FcγRIII (low affinity), Gran, Macro, NK Cell, 50-70kD, Clone: BL-LGL/3, Mouse Monoclonal antibody-Human; NO paraffin 1000ul Ask price € accurate-monoclonals human
YM1187F CD16, FcγRIII (low affinity), Granulocyte, Macrophage, NK Cell, Clone: 3G8, Mouse Monoclonal antibody-Hu, FITC; flow 500ul 735 € accurate-monoclonals human
YM1187R CD16, FcγRIII (low affinity), Granulocyte, Macrophage, NK Cell, Clone: 3G8, Mouse Monoclonal antibody-Hu, RPE; flow 500ul 853 € accurate-monoclonals human
YM1187T CD16, FcγRIII (low affinity), Granulocyte, Macrophage, NK Cell, Clone: 3G8, Mouse Monoclonal antibody-Hu, Tri-Color; flow 500ul 978 € accurate-monoclonals human
BYA9201-1 CD16, FcγRIII (low affinity), Granulocyte, NK Cell, Clone: 3G8, Mouse Monoclonal antibody-Human, FITC; flow vial 718 € accurate-monoclonals human
MBS624493 FCGR2B (CD32, Low Affinity Immunoglobulin gamma Fc Region Receptor II-b, IgG Fc Receptor II-b, CDw32, Fc-gamma RII-b, Fc-gamma-RIIb, FcRII-b, CD32, FCG2, IGFR2) Antibody 50ug 619 € MBS Polyclonals_1 human
MBS620081 Nerve Growth Factor Receptor, p75 (NGFR, NGF Receptor, CD271, Gp80 LNGFR, Low Affinity Neurotrophin Receptor p75NTR, p75 ICD, p75 Neurotrophin, p75 NTR, Tumor Necrosis Factor Receptor Superfamily Member 16, TNFR Superfamily Member 16, TNFRSF16) Antibody 100ul 652 € MBS Polyclonals_1 human
CS29 Recombinant Mouse Fc γ RIIIA, FCGR3, CD16 (C-6His) 10 µg 146 € novo human
GENTAUR-58bdc2d27f4c3 Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc459e5688 Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc767017e3 Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc76769305 Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc79de2961 Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc79e59d7b Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc96ca7a40 Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd0e8e66d0 Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdd0e959f6f Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdd65c86345 Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd98ed4c49 Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddd4624f74 Anti- Fc Fragment Of IgG Low Affinity IIIa Receptor (FcgR3A) Antibody 100ug 580 € MBS Polyclonals human