Recombinant Mouse Fc Receptor-like Protein 1, FCRL1, FcRH1 (C-6His)

Contact us
Catalog number: CP47
Price: 100 €
Supplier: novo
Product name: Recombinant Mouse Fc Receptor-like Protein 1, FCRL1, FcRH1 (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Fc receptor-like protein 1 is produced by our expression system and the target gene encoding Ala17-Ser219 is expressed with a 6His tag at the C-terminus
Molecular Weight: 22, 5 kD
UniProt number: Q8R4Y0
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIASELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLSHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: FCRL1, FcRH1 (C-6His), Fc Receptor-like Protein 1
Short name: FCRL1, FcRH1 (C-6His), Recombinant Mouse Fc Receptor-like Protein 1
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: FcRH1 (C-6His), fragment c receptor-like 1, recombinant Mouse fragment c Receptor-like Protein 1
Alternative technique: rec
Alternative to gene target: FCRL1 and IDBG-103709 and ENSG00000163534 and 115350, FCRL1 and IDBG-631097 and ENSBTAG00000005891 and 517846, Fcrl1 and IDBG-157118 and ENSMUSG00000059994 and 229499, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, Fc receptor-like 1
Identity: 18509
Gene: FCRL1 | More about : FCRL1
Long gene name: Fc receptor like 1
Synonyms gene name: Fc receptor-like 1
Synonyms: FCRH1 IRTA5 IFGP1 CD307a
Locus: 1q23, 1
Discovery year: 2005-03-22
GenBank acession: BC033690
Entrez gene record: 115350
Pubmed identfication: 11493702 11929751
RefSeq identity: NM_052938
Classification: CD molecules Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000019398

Related Products :

CP47 Recombinant Mouse Fc Receptor-like Protein 1, FCRL1, FcRH1 (C-6His) 50 µg 303 € novo mouse
RP-1282M Recombinant Mouse FCRL1 / FCRH1 Protein (His Tag) 50μg 624 € adv mouse
RP-0676H Recombinant Human FCRL1 / FCRH1 Protein (His Tag) 50μg 624 € adv human
C607 Recombinant Human Fc Receptor-Like Protein 1, FCRL1, CD307a (C-6His) 50 µg 273 € novo human
GENTAUR-58bdeee7c0e64 Anti- FCRL1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdeee80dd7f Anti- FCRL1 Antibody 0.12 ml 348 € MBS Polyclonals human
abx916711 Anti-FCRL1 siRNA 15 nmol 528 € abbex human
abx916712 Anti-FCRL1 siRNA 30 nmol 717 € abbex human
GWB-MR831C FCRL1 antibody 1 vial 440 € genways human
R36048-100UG FCRL1 Antibody 0.1mg 406 € NJS poly human
R36126-100UG FCRL1 Antibody 0.1mg 406 € NJS poly human
LV159036 FCRL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV159037 FCRL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV159038 FCRL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV159039 FCRL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV159041 FCRL1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV159040 FCRL1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GWB-B54AFB FCRL1 Over-expression Lysate reagent 1 vial 463 € genways human
MBS615516 APJ Receptor (APLNR, Apelin receptor, AGTRL1, angiotensin II receptor-like 1, Angiotensin receptor-like 1, Apelin receptor, APJ, APJR, FLJ90771, G-protein coupled receptor APJ, HG11, MGC45246) Antibody 0.05 ml 536 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
CK89 Recombinant Mouse IL-1 Receptor-Like 1, IL-1RL1, IL-1 R4 (C-6His) 50 µg 303 € novo mouse
CM42 Recombinant Mouse Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 10 µg 126 € novo mouse
MBS613784 PAEL Receptor (GPR37, G Protein Coupled Receptor 37, ETBR-LP-1, Endothelin B Receptor-like Protein 1, PAELR, Parkin-Associated Endothelin Receptor-Like Receptor) 50ug 724 € MBS Polyclonals_1 human
MBS610724 TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3) 100ug 730 € MBS Polyclonals_1 human
MBS610221 TLR5 (Toll Like Receptor 5, Toll-like Receptor 5 Precursor, TLR 5, TLR-5, FLJ10052, MGC126430, MGC126431, Toll/interleukin 1 Receptor-like Protein 3, TIL3) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS623300 EphA4 (Ephrin Receptor Eph A4, Ephrin Receptor EphA4, Ephrin Type A Receptor 4, EPH Receptor A4, Eph A4, EPH-like Kinase 8, EK8, HEK8, Receptor Protein Tyrosine Kinase HEK8, SEK, TYRO1 Protein Tyrosine Kinase, Tyrosine Protein Kinase Receptor SEK, Tyrosin Antibody 50ug 928 € MBS Polyclonals_1 human
MBS622505 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Ox-1-R, Ox1-R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) Antibody 100ug 652 € MBS Polyclonals_1 human
C269 Recombinant Human GABA Receptor-Associated Protein-Like 1, GABARAPL1 (N-6His) 1 mg 2283 € novo human
CI84 Recombinant Human IL-1 Receptor-Like 1, IL-1RL1, ST2 (C-6His) 10 µg 100 € novo human