Recombinant Human IL-1 Receptor-Like 1, IL-1RL1, ST2 (C-6His)

Contact us
Catalog number: CI84
Price: 521 €
Supplier: genways
Product name: Recombinant Human IL-1 Receptor-Like 1, IL-1RL1, ST2 (C-6His)
Quantity: 1 vial
Other quantities: 1 mg 1115€ 500 µg 709€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interleukin-1 receptor-like 1 is produced by our Mammalian expression system and the target gene encoding Lys19-Phe328 is expressed with a 6His tag at the C-terminus
Molecular Weight: 36 kD
UniProt number: Q01638-2
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECFVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Gene: ST2 | More about : ST2
Group: recombinants
Gene target: IL-1RL1, ST2 (C-6His), IL-1 Receptor-Like 1
Short name: IL-1RL1, ST2 (C-6His), Recombinant IL-1 Receptor-Like 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Interleukin-1RL1, ST2 (C-6His), sapiens Interleukin-1 Receptor-Like 1, recombinant H
Alternative technique: rec
Identity: 11347
Long gene name: suppression of tumorigenicity 2
Locus: 11p14, 3-p12
Discovery year: 1988-08-31
Entrez gene record: 6761

Related Products :

CI84 Recombinant Human IL-1 Receptor-Like 1, IL-1RL1, ST2 (C-6His) 10 µg 100 € novo human
CK89 Recombinant Mouse IL-1 Receptor-Like 1, IL-1RL1, IL-1 R4 (C-6His) 50 µg 303 € novo mouse
CK95 Recombinant Mouse IL-1 Receptor-Like 1, IL-1RL1, IL-1 R4 (C-Fc) 500 µg 1613 € novo mouse
CEK1221 anti-Human IL-1RL1 ELISA Kit Antibody 96 Tests 703 € acr human
CEK1501 anti-Mouse IL-1RL1 ELISA Kit Antibody 96 Tests 703 € acr mouse
RP-0893H Recombinant Human IL1RL1 / ST2 Protein (His Tag) 100μg 659 € adv human
RP-0892H Recombinant Human IL1RL1 / ST2 Protein (isoform a, His Tag) 50μg 624 € adv human
MBS615516 APJ Receptor (APLNR, Apelin receptor, AGTRL1, angiotensin II receptor-like 1, Angiotensin receptor-like 1, Apelin receptor, APJ, APJR, FLJ90771, G-protein coupled receptor APJ, HG11, MGC45246) Antibody 0.05 ml 536 € MBS Polyclonals_1 human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
101-M642 Anti-Human ST2 100ug 336 € Reliatech antibodies human
abx570002 Anti-Human Syntenin 2 (ST2) ELISA Kit inquire 50 € abbex human
GWB-SKR248 Human ST2 96 well plate ELISA assay Kit 1 96 well plate ELISA plate 612 € genways human
DL-ST2-Hu Human Syntenin 2 ST2 ELISA Kit 96T 904 € DL elisas human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
AM26439AF-N anti-IL1RL1 / ST2 Antibody 0,1 mg 601 € acr human
AM26440AF-N anti-IL1RL1 / ST2 Antibody 0,1 mg 601 € acr human
AM26441AF-N anti-IL1RL1 / ST2 Antibody 0,1 mg 601 € acr human
AM26441FC-N anti-IL1RL1 / ST2 Antibody 100 Вµl 601 € acr human
AM26441RP-S anti-IL1RL1 / ST2 Antibody 1,0 ml 601 € acr human
AP30829CP-N anti-IL1RL1 / ST2 Control Peptide Antibody 50 Вµg 282 € acr human
DM3563P anti-IL1RL1 / ST2 (Extracell. Dom.) Antibody 0,1 mg 688 € acr human
MBS223263 Anti-MOUSE ST2 (N-TERMINAL) 50ug 343 € MBS Polyclonals_1 human
MBS221876 Anti-MOUSE ST2 (N-TERMINAL) Antibody 100ug 442 € MBS Polyclonals_1 human
GENTAUR-58be609376354 Anti-ST2 (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
GENTAUR-58be23ac90341 Monocloncal Antibody to mosue T1/ST2 FITC 500ul 763 € MBS mono human
GENTAUR-58be23abe40d5 Monocloncal Antibody to mouse T1/ST2 Biotinylated 500ul 801 € MBS mono human
GENTAUR-58be23b40825a Monocloncal Antibody to mouse T1/ST2 purified 500ul 741 € MBS mono human
GENTAUR-58be23b32196d Monocloncal Antibody to mouse T1/ST2 purified, azide-free 500ul 801 € MBS mono human
GWB-EA8691 Mouse ST2 antibody (N-terminus) 1 vial 400 € genways mouse
GWB-F097AE Mouse ST2 antibody (N-terminus) 1 vial 521 € genways mouse