Recombinant Mouse Complement Factor D, Adipsin (C-10His)

Contact us
Catalog number: CP03
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Mouse Complement Factor D, Adipsin (C-10His)
Quantity: 0.1ml
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Complement factor D is produced by our Mammalian expression system and the target gene encoding Ile26-Ser259 is expressed with a 10His tag at the C-terminus
Molecular Weight: 26, 8 kD
UniProt number: P03953
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mMsodium chloride, 2 um filtered solution of 20 mMTris, 5, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTSHHHHHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: Adipsin (C-10His), Complement Factor D
Short name: Adipsin (C-10His), Recombinant Mouse Complement Factor D
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Adipsin (C-10His), recombinant Mouse Complement Factor D
Alternative technique: rec

Related Products :

CP03 Recombinant Mouse Complement Factor D, Adipsin (C-10His) 10 µg 202 € novo mouse
CP27 Recombinant Human Complement Factor D, Adipsin (C-10His) 1 mg 2486 € novo human
RP-1012M Recombinant Mouse Adipsin / Complement Factor D / CFD Protein (His Tag) 20μg 572 € adv mouse
RP-0028H Recombinant Human Adipsin / Complement Factor D / CFD Protein (His Tag) 10μg 624 € adv human
CP25 Recombinant Mouse α-2-HS-Glycoprotein, , AHSG, Fetuin A (C-10His) 500 µg 1009 € novo human
CS72 Recombinant Mouse Alpha-Fetoprotein, AFP (C-10His) 1 mg 2283 € novo mouse
CS87 Recombinant Mouse Myeloperoxidase, MPO (C-10His) 10 µg 156 € novo mouse
CS85 Recombinant Mouse Renin (C-10His) 500 µg 1328 € novo mouse
CS34 Recombinant Mouse TNF ligand superfamily member 9, TNFSF9(N-10His) 1 mg 1877 € novo mouse
CS17 Recombinant Human Hypoxia up-Regulated Protein 1, HYOU1 (C-10His) 10 µg 156 € novo human
C668 Recombinant Human Interferon Lambda-1, IL-29, IFN-λ1 (C-10His) 10 µg 126 € novo human
CS73 Recombinant Human Myeloperoxidase, MPO (C-10His) 500 µg 303 € novo human
CS01 Recombinant Human Olfactomedin-4, OLFM4 (C-10His) 10 µg 202 € novo human
CS84 Recombinant Human Renin (C-10His) 1 mg 1877 € novo human
CP26 Recombinant Macaca mulatta α-2-HS-Glycoprotein, AHSG, Fetuin A (C-10His) 10 µg 110 € novo human
MBS613925 Adipsin (Factor D) 100ug 757 € MBS Polyclonals_1 human
MBS613925 Adipsin (Factor D) Antibody 50ug 492 € MBS Polyclonals_1 human
MBS614707 Adipsin (Factor D) Antibody 100ul 724 € MBS Polyclonals_1 human
GENTAUR-58be5d32273ee Anti-Factor D/Adipsin (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-13130R-A350 Factor D/Adipsin Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13130R-A488 Factor D/Adipsin Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13130R-A555 Factor D/Adipsin Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13130R-A594 Factor D/Adipsin Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13130R-A647 Factor D/Adipsin Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-13130R-Biotin Factor D/Adipsin Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-13130R Factor D/Adipsin Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-13130R-Cy3 Factor D/Adipsin Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13130R-Cy5 Factor D/Adipsin Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13130R-Cy5.5 Factor D/Adipsin Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-13130R-Cy7 Factor D/Adipsin Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human