Recombinant Mouse TNF-Like 1, TL1A, TNFSF15

Contact us
Catalog number: CM93
Price: 558 €
Supplier: acr
Product name: Recombinant Mouse TNF-Like 1, TL1A, TNFSF15
Quantity: 0,1 mg
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse TNF-like 1 is produced by our E, coli expression system and the target gene encoding Ile76-Leu252 is expressed
Molecular Weight: 20 kD
UniProt number: Q5UBV8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITMVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGATFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene: TNFSF15 | More about : TNFSF15
Gene target: TL1A, TNFSF15, TNF-Like 1
Short name: TL1A, TNFSF15, Recombinant Mouse TNF-Like 1
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: TL1A, member 15, tumor necrosis factor (ligand) superfamily, recombinant Mouse tumor necrosis factor-Like 1
Alternative technique: rec
Alternative to gene target: DIF and TNF-alpha and TNFA and TNFSF2, DNA-templated and biological process this GO :0045893 and positive regulation of transcription, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0045994 and positive regulation of translational initiation by iron and biological process this GO :0046325 and negative regulation of glucose import and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0048566 and embryonic digestive tract development and biological process this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0050708 and regulation of protein secretion and biological process this GO :0050715 and positive regulation of cytokine secretion and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0050796 and regulation of insulin secretion and biological process this GO :0050806 and positive regulation of synaptic transmission and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0050900 and leukocyte migration and biological process this GO :0050901 and leukocyte tethering or rolling and biological process this GO :0050966 and detection of mechanical stimulus involved in sensory perception of pain and biological process this GO :0050995 and negative regulation of lipid catabolic process and biological process this GO :0051023 and regulation of immunoglobulin secretion and biological process this GO :0051044 and positive regulation of membrane protein ectodomain proteolysis and biological process this GO :0051091 and positive regulation of sequence-specific DNA binding transcription factor activity and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process this GO :0051222 and positive regulation of protein transport and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051533 and positive regulation of NFAT protein import into nucleus and biological process this GO :0051798 and positive regulation of hair follicle development and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055037 and recycling endosome and cellular component this GO :0060557 and positive regulation of vitamin D biosynthetic process and biological process this GO :0060559 and positive regulation of calcidiol 1-monooxygenase activity and biological process this GO :0060664 and epithelial cell proliferation involved in salivary gland morphogenesis and biological process this GO :0060693 and regulation of branching involved in salivary gland morphogenesis and biological process this GO :0061048 and negative regulation of branching involved in lung morphogenesis and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071230 and cellular response to amino acid stimulus and biological process this GO :0071316 and cellular response to nicotine and biological process this GO :0071407 and cellular response to organic cyclic compound and biological process this GO :0071677 and positive regulation of mononuclear cell migration and biological process this GO :0071803 and positive regulation of podosome assembly and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :0097527 and necroptotic signaling pathway and biological process this GO :1990268 and response to this GO ld nanoparticle and biological process this GO :2000010 and positive regulation of protein localization to cell surface and biological process this GO :2000343 and positive regulation of chemokine (C-X-C motif) ligand 2 production and biological process this GO :2000377 and regulation of reactive oxygen species metabolic process and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, Extracellular, Extracellular, TL1 and TL1A and VEGI and VEGI192A, TNF and IDBG-300259 and ENSG00000232810 and 7124, TNF and IDBG-634161 and ENSBTAG00000025471 and 280943, TNFSF15 and IDBG-638648 and ENSBTAG00000018069 and 514239, TNFSF15 and IDBG-82298 and ENSG00000181634 and 9966, Tnf and IDBG-177358 and ENSMUSG00000024401 and 21926, Tnfsf15 and IDBG-155748 and ENSMUSG00000050395 and 326623, member 15, protein binding, this GO :0000060 and protein import into nucleus, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding and also this GO :0044212 : transcription regulatory region DNA binding, this GO :0005102 and receptor binding and molecular function this GO :0005123 and death receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007250 and activation of NF-kappaB-inducing kinase activity and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0042107 and cytokine metabolic process and biological process this GO :0050715 and positive regulation of cytokine secretion and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005123 : death receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding, this GO :0005123 : death receptor binding, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0005515 : protein binding, this GO :0042802 : identical protein binding, this GO :0044212 : transcription regulatory region DNA binding, transcription regulatory region DNA binding, translocation and biological process this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0000165 and MAPK cascade and biological process this GO :0000185 and activation of MAPKKK activity and biological process this GO :0000187 and activation of MAPK activity and biological process this GO :0001666 and response to hypoxia and biological process this GO :0001775 and cell activation and biological process this GO :0001819 and positive regulation of cytokine production and biological process this GO :0001891 and pha this GO cytic cup and cellular component this GO :0001932 and regulation of protein phosphorylation and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002020 and protease binding and molecular function this GO :0002037 and negative regulation of L-glutamate transport and biological process this GO :0002439 and chronic inflammatory response to antigenic stimulus and biological process this GO :0002740 and negative regulation of cytokine secretion involved in immune response and biological process this GO :0002876 and positive regulation of chronic inflammatory response to antigenic stimulus and biological process this GO :0002925 and positive regulation of humoral immune response mediated by circulating immunoglobulin and biological process this GO :0003009 and skeletal muscle contraction and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006006 and glucose metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006919 and activation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0006927 and transformed cell apoptotic process and biological process this GO :0006952 and defense response and biological process this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007254 and JNK cascade and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0009314 and response to radiation and biological process this GO :0009612 and response to mechanical stimulus and biological process this GO :0009615 and response to virus and biological process this GO :0009651 and response to salt stress and biological process this GO :0009887 and organ morphogenesis and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010693 and negative regulation of alkaline phosphatase activity and biological process this GO :0010888 and negative regulation of lipid storage and biological process this GO :0014823 and response to activity and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0019722 and calcium-mediated signaling and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030316 and osteoclast differentiation and biological process this GO :0030730 and sequestering of triglyceride and biological process this GO :0031334 and positive regulation of protein complex assembly and biological process this GO :0031622 and positive regulation of fever generation and biological process this GO :0031663 and lipopolysaccharide-mediated signaling pathway and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032715 and negative regulation of interleukin-6 production and biological process this GO :0032722 and positive regulation of chemokine production and biological process this GO :0032729 and positive regulation of interferon-gamma production and biological process this GO :0032741 and positive regulation of interleukin-18 production and biological process this GO :0032755 and positive regulation of interleukin-6 production and biological process this GO :0032800 and receptor biosynthetic process and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0034116 and positive regulation of heterotypic cell-cell adhesion and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042346 and positive regulation of NF-kappaB import into nucleus and biological process this GO :0042493 and response to drug and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0042802 and identical protein binding and molecular function this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0043068 and positive regulation of programmed cell death and biological process this GO :0043122 and regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043242 and negative regulation of protein complex disassembly and biological process this GO :0043243 and positive regulation of protein complex disassembly and biological process this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0043491 and protein kinase B signaling and biological process this GO :0043507 and positive regulation of JUN kinase activity and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0044130 and negative regulation of growth of symbiont in host and biological process this GO :0044212 and transcription regulatory region DNA binding and molecular function this GO :0045071 and negative regulation of viral genome replication and biological process this GO :0045080 and positive regulation of chemokine biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045123 and cellular extravasation and biological process this GO :0045416 and positive regulation of interleukin-8 biosynthetic process and biological process this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0045668 and negative regulation of osteoblast differentiation and biological process this GO :0045670 and regulation of osteoclast differentiation and biological process this GO :0045672 and positive regulation of osteoclast differentiation and biological process this GO :0045760 and positive regulation of action potential and biological process this GO :0045840 and positive regulation of mitosis and biological process this GO :0045892 and negative regulation of transcription, tumor necrosis factor, tumor necrosis factor (ligand) superfamily
Identity: 11931
Long gene name: tumor necrosis factor superfamily member 15
Synonyms gene name: member 15 , tumor necrosis factor (ligand) superfamily
Synonyms: TL1 VEGI TL1A VEGI192A MGC129934 MGC129935
Synonyms name: vascular endothelial cell growth inhibitor TNF superfamily ligand TL1A TNF ligand-related molecule 1 vascular endothelial growth inhibitor-192A
Locus: 9q32
Discovery year: 1998-12-04
GenBank acession: AF039390
Entrez gene record: 9966
Pubmed identfication: 9434163
RefSeq identity: NM_005118
Classification: Tumor necrosis factor superfamily
Havana BLAST/BLAT: OTTHUMG00000021011

Related Products :

CM93 Recombinant Mouse TNF-Like 1, TL1A, TNFSF15 1 mg 2486 € novo mouse
C038 Recombinant Human TNF-Like 1, TL1A, TNFSF15 10 µg 168 € novo human
GWB-D3C992 TNF Ligand Superfamily, Member 15 (TL1A/TNFSF15) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
GWB-6352D0 TNF Ligand Superfamily, Member 15 (TL1A/TNFSF15) Rabbit antibody to or anti-Human Polyclonal (N- terminus) antibody 1 tube 602 € genways human
RP-1513H Recombinant Human TL1A / TNFSF15 Protein (Fc Tag) 20μg 456 € adv human
MBS242030 Anti-Human TNFSF15 / TL1A / VEGI 50ug 597 € MBS Polyclonals_1 human
MBS619623 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu Antibody 100ug 652 € MBS Polyclonals_1 human
TNFR25-R-20 Recombinant purified human TNF Receptor 2 (TNFR2/TNF-RII, Etannercept/TNF-R75, p75TNFR) protein (E.Coli, His-tag) 10 μg 333 € adi human
MBS624468 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR 2, Tnfr2, Tnfr-2, TNF-R2, Tumor Necrosis Factor Receptor Type II, TNFRII, TNFR-II, TNF-RII, TNF-R-II, CD120b, p75, p80 TNF alpha Receptor, TNF-R75, TNFR80, TNFalpha-R2, TNF-alphaR2, Tumor Necrosis Factor bet 1 mililiter 1061 € MBS Polyclonals_1 human
MBS223395 Anti-TL1A (N-TERMINAL) Antibody 100ug 437 € MBS Polyclonals_1 human
MBS223969 Anti-TL1A (N-TERMINAL) Antibody 50ug 299 € MBS Polyclonals_1 human
MBS150074 TL1A Antibody 100ug 431 € MBS Polyclonals_1 human
MBS150585 TL1A Antibody 100ug 431 € MBS Polyclonals_1 human
MBS535934 TL1A antibody 50ug 470 € MBS Polyclonals_1 human
MBS273098 TL1A antibody [C2C3], C-term 100ul 426 € MBS Polyclonals_1 human
GWB-5851DE TL1A antibody (N-terminus) 1 x 1 vial 337 € genways human
GWB-8A606C TL1A antibody (N-terminus) 1 vial 516 € genways human
ZP-3109 TL1A Peptide 0.05 mg 204 € Zyagen human
APO-3109 TL1A Rabbit Polyclonal Antibody 0.1 mg 428 € Zyagen human
APO-3789 TL1A Rabbit Polyclonal Antibody 0.1 mg 428 € Zyagen human
6424 Recombinant Chicken TNFSF15 5 µg 220 € Immunochemistry kits chicken
GWB-P0989A TNFSF15, 72-251aa, Recombinant Protein bulk Ask price € genways bulk human
MBS621181 ADAM17 (CD156b, Disintegrin and Metalloproteinase Domain-containing Protein 17, TNF-alpha-converting Enzyme, TNF-alpha Convertase, Snake Venom-like Protease, CSVP, TACE) Antibody 50ug 873 € MBS Polyclonals_1 human
DEV104-8-2/02 TNF alpha, Clone: TNF-E7, Mouse Monoclonal antibody-Human 200ug 448 € accurate-monoclonals human
DEV104-8-2/1 TNF alpha, Clone: TNF-E7, Mouse Monoclonal antibody-Human 1 mg Ask price € accurate-monoclonals human
MBS621839 TBP-like Protein (TBP Like Protein TLP, TLP, TATA Box Binding Protein-like Protein 1, TBP-like 1, TBP-like Protein 1, TBPL1, 21kDa TBP-like Protein, Second TBP of Unique DNA, STUD, TATA Box Binding Protein-related Factor 2, TBP-related Factor 2, TRF2, TLF Antibody 100ug 735 € MBS Polyclonals_1 human
AR09989PU-L anti-TNFSF15 (72-251, His-tag) Antibody 0,5 mg 1138 € acr human
AR09989PU-N anti-TNFSF15 (72-251, His-tag) Antibody 0,1 mg 485 € acr human
A01T0159 anti-TNFSF15 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AP06649PU-N anti-TNFSF15 Antibody 0,1 mg 558 € acr human