Recombinant Mouse CD83, HB15 (C-6His)

Contact us
Catalog number: CM53
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Mouse CD83, HB15 (C-6His)
Quantity: 20 ug
Other quantities: 1 mg 1877€ 50 µg 232€ 500 µg 1328€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse CD83 is produced by our Mammalian expression system and the target gene encoding Met22-Ala134 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17, 4 kD
UniProt number: O88324
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: HB15 (C-6His), CD83
Short name: HB15 (C-6His), Recombinant Mouse CD83
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: HB15 (C-6His), recombinant Mouse CD83 molecule
Alternative technique: rec
Alternative to gene target: BL11 and HB15, CD83 and IDBG-62750 and ENSG00000112149 and 9308, CD83 and IDBG-636028 and ENSBTAG00000031430 and 617034, Cd83 and IDBG-147707 and ENSMUSG00000015396 and 12522, Cell surfaces, alpha-beta T cell differentiation and biological process, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006952 and defense response and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0014070 and response to organic cyclic compound and biological process this GO :0032713 and negative regulation of interleukin-4 production and biological process this GO :0032733 and positive regulation of interleukin-10 production and biological process this GO :0032743 and positive regulation of interleukin-2 production and biological process this GO :0043372 and positive regulation of CD4-positive, this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD83 molecule
Identity: 1703
Gene: CD83 | More about : CD83
Long gene name: CD83 molecule
Synonyms gene name: CD83 antigen (activated B lymphocytes, immunoglobulin superfamily) CD83 molecule
Synonyms: HB15 BL11
Locus: 6p23
Discovery year: 1999-03-26
GenBank acession: Z11697
Entrez gene record: 9308
Pubmed identfication: 1378080 8422464
Classification: CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000014283

Related Products :

CM53 Recombinant Mouse CD83, HB15 (C-6His) 50 µg 232 € novo mouse
C403 Recombinant Human CD83, HB15 (C-6His) 50 µg 273 € novo human
CM01 Recombinant Mouse CD83, HB15 (C-Fc) 500 µg 1328 € novo mouse
RP-1166M Recombinant Mouse CD83 / HB15 Protein (Fc Tag) 50μg 624 € adv mouse
RP-1165M Recombinant Mouse CD83 / HB15 Protein (His Tag) 50μg 624 € adv mouse
CD40 Recombinant Human CD83, HB15 (C-Fc) 1 mg 2283 € novo human
RP-0369H Recombinant Human CD83 / HB15 Protein (His Tag) 50μg 624 € adv human
GENTAUR-58bcd9a926e01 Mouse CD83 antigen (Cd83) 100ug 1398 € MBS Recombinant Proteins mouse
GENTAUR-58bcd9a97f34e Mouse CD83 antigen (Cd83) 1000ug 1398 € MBS Recombinant Proteins mouse
GENTAUR-58bcd9a9bc745 Mouse CD83 antigen (Cd83) 100ug 1901 € MBS Recombinant Proteins mouse
GENTAUR-58bcd9aa11b08 Mouse CD83 antigen (Cd83) 1000ug 1901 € MBS Recombinant Proteins mouse
YSRTMCA2747 CD83, Rat Mouse Monoclonal antibody-Mouse; Clone: 3D11, flow 0.25 mg 391 € accurate-monoclonals mouse
YSRTMCA2747GA CD83, Rat Mouse Monoclonal antibody-Mouse; Clone: 3D11, flow 0.1 mg 265 € accurate-monoclonals mouse
YSRTMCA2747A488 CD83, Rat Mouse Monoclonal antibody-Mouse; Clone: 3D11, flow, Alexa 488 conj. 100 tests Ask price € accurate-monoclonals mouse
YSRTMCA2747A647 CD83, Rat Mouse Monoclonal antibody-Mouse; Clone: 3D11, flow, Alexa 647 conj. 100 tests Ask price € accurate-monoclonals mouse
YSRTMCA2747F CD83, Rat Mouse Monoclonal antibody-Mouse; Clone: 3D11, flow, FITC conj. 0.1 mg 315 € accurate-monoclonals mouse
abx262450 Anti-CD83 Protein (Recombinant) 10 µg 340 € abbex human
RP-1057RC Recombinant Cynomolgus CD83 Protein (Fc Tag) 50μg 624 € adv human
RP-2075R Recombinant Rat CD83 Protein (Fc Tag) 50μg 624 € adv rat
RP-2076R Recombinant Rat CD83 Protein (His Tag) 50μg 624 € adv rat
abx153803 Anti-Mouse CD83 ELISA Kit 96 tests 920 € abbex mouse
abx576398 Anti-Mouse CD83 ELISA Kit inquire 50 € abbex mouse
MEDCLA898-01 CD83, Clone: 1H4b, Mouse Monoclonal antibody-Human 0.1000ul 428 € accurate-monoclonals human
MEDCLA898-1 CD83, Clone: 1H4b, Mouse Monoclonal antibody-Human 1000ul 1081 € accurate-monoclonals human
YSRTMCA1582A488 CD83, Clone: HB15A, Mouse Monoclonal antibody-, ALEXA 488 conj. vial Ask price € accurate-monoclonals mouse
YSRTMCA1582A488T CD83, Clone: HB15A, Mouse Monoclonal antibody-, ALEXA 488 conj. vial Ask price € accurate-monoclonals mouse
YSRTMCA1582A647 CD83, Clone: HB15A, Mouse Monoclonal antibody-, ALEXA 647 conj. vial Ask price € accurate-monoclonals mouse
YSRTMCA1582A647T CD83, Clone: HB15A, Mouse Monoclonal antibody-, ALEXA 647 conj. vial Ask price € accurate-monoclonals mouse
YSRTMCA1582GA CD83, Clone: HB15A, Mouse Monoclonal antibody-Human 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1582T CD83, Clone: HB15A, Mouse Monoclonal antibody-Human 20 ug Ask price € accurate-monoclonals human